CAZyme Information: MGYG000001503_01634

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_01634
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		37324.86	9.1398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 779210; End: 780184 Strand: +

Full Sequence      

MKKSLLFSLVILLAALVTSVVLLTSGNDPVKTEIEKPQVLSMTASVSIPERMTFAGEEIV
FDRYDKRERMDRELNSFTYFHSTTMLLIKRANRVFPIIEPILKREGIPDDMKYLAVIESN
LDHRAVSPASAVGLWQFIQTAGRENGLEIRSEVDERYHIEKSTVAACKYLKNAYRRYGSW
SAASMSYNGGQGRITNELRNQKAEDALDLWLVEETTRYYYRMLAIKQIFENPQQYGFVIK
PEHLYKPMEFKKVDVTNTIPDLVSFAREHGITYAQLKDFNSWLRSDKLNNASGKKYTILI
PTEEDLYYKKGGKPKVHNPAWVVD

Enzyme Prediction     

No EC number prediction in MGYG000001503_01634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	233	2.1e-21	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.52e-54	102	227	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	6.85e-25	53	301	64	311	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.80e-21	97	205	1	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	2.69e-12	114	193	5	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.40e-09	96	231	8	145	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA15013.1	1.11e-234	1	324	1	324
SCD19360.1	7.73e-178	1	323	1	324
QRX64913.1	1.47e-166	23	323	25	325
SCM59513.1	1.19e-162	10	324	11	323
BBD44537.1	7.98e-161	1	323	1	322

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	4.55e-24	67	301	78	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	4.55e-24	67	301	78	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	1.57e-06	79	202	10	134	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.194515	0.498324	0.306124	0.000310	0.000303	0.000402

TMHMM  Annotations     

start	end
5	27