CAZyme Information: MGYG000001503_02067

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_02067
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		22753.2	9.7294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1272596; End: 1273186 Strand: -

Full Sequence      

MDKGVFFKIISKTLFFGRLTPHQKRGVETKLTAFDIYDIVDDRWRAYMLATVLHETGGEM
QPVEEVGKGAGRPYGKKLKHDRTVYTFPDRLYYGRGDVQLTWYENYELMGKLLNYPLLKY
PELALEPEISARIMIEGMTRGISNRGDFTGVSLENYFNNHKEDPINARRIVNGLDRASLI
AKYYRLFLNAIRISKN

Enzyme Prediction     

No EC number prediction in MGYG000001503_02067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	41	133	1e-15	0.4025974025974026

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	8.60e-07	48	135	52	149	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
COG3179	COG3179	1.24e-04	45	173	42	185	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	1.28e-04	88	130	103	146	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA17011.1	1.94e-137	1	195	1	195
CEA15296.1	1.13e-98	2	191	5	194
QRX64201.1	9.31e-88	1	194	2	195
QRX62884.1	3.51e-80	1	192	1	192
QRX62908.1	1.65e-78	1	192	1	192

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	1.12e-07	14	123	11	122	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O22841	1.85e-06	33	130	127	219	Endochitinase At2g43620 OS=Arabidopsis thaliana OX=3702 GN=At2g43620 PE=3 SV=1
O22842	3.37e-06	46	123	139	209	Endochitinase At2g43610 OS=Arabidopsis thaliana OX=3702 GN=At2g43610 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_02067.