CAZyme Information: MGYG000001503_02107

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_02107
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		27078.02	6.332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1322893; End: 1323627 Strand: +

Full Sequence      

MEAPNPVNVQSFGGAYSEEAIALLQKEGPKYQYGTGCLSDGILGMWMASVCGLPEIIDNK
MVTSHLKAVHKYNLKTTLLDHYNPQRPTYACGEDGGLLLCSWPKGGALSLPFVYSNEVWT
GIEYQVASHLMLKGEIEKGLEIVRICRDRYDGSVRNPFNEYECGHWYARAMASYAMIQAL
TGIRYDAVDKILYIDSKIGDFTSFISTGTGFGTLSLKNGKPRLEVLFGSIDVNKYNIFGK
EINL

Enzyme Prediction     

No EC number prediction in MGYG000001503_02107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	34	176	1.3e-29	0.3746556473829201

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04685	DUF608	1.40e-32	33	176	225	362	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	3.07e-08	35	142	579	670	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD18849.1	1.99e-169	1	244	769	1012
BBD44047.1	1.80e-143	1	244	769	1012
QQA30036.1	1.20e-137	1	243	728	970
QUT61530.1	1.98e-137	1	243	750	992
QUT37384.1	1.98e-137	1	243	750	992

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_02107.