CAZyme Information: MGYG000001503_02120

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_02120
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1132		129446.67	5.1037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1339869; End: 1343267 Strand: -

Full Sequence      

MKKLSVYLAGVLTLLVFALSVNAQEYDYISKERKTPYWRDVNVVKAHKEYPRTQFMTFEN
ENDALSKKFEESEYYISLNGTWKFYFVESYTELPENVTDSAVVLTDWKDIKVPGNWEIQG
FGTPIYVNHPYEFVERDPKTFYPKMEAPYLPEETPVGVYRREINIPENWNDREIFLTLDG
AKSGVYVYINGKEVGYSEDSKTSAEFNITKYVNEGTNSLVLKIYRWSTGSYLEAQDFWRI
SGIERDVFLWSQAKTSLRDFRVKSTLDDSYLNGIFELETTVRNYSQAVSYANVSYKLLDS
DGNTVLSDSKPIGVQRGGESSVRFSAEIPNVSTWTSEQPNLYKLLITVIPEGEEKGEVVP
YPVGFRRFEIVPYKTGDRIDRLFLVNGQPIKLKGVNIHETNPETGHYVTEDIMIKDFTLM
KLNNINSVRLSHYPQSRRFYELCNIYGLYVYDEANIESHGLYYGEKSPSKHPEWEQAHMD
RTINMFERNKNHPSVTIWSLGNEAGNGINFFHTYRYLKDQERDFMNRPVNYERSLWDLNT
DMYVPQYPSAAWLEEIGAKGSDRPVIPSEYSHAMGNSNGNIDIQWEAIYKYPNLQGAYIW
DWVDQGIAKKDEDGRSFWAYGGDYGIDTPSDGNFVINGLVDPGRVPHPAVAEVKYVHQNF
AFEAIDLKEGIFKVINRQYFTDTENYKFLYNVTENGNIISEGELSVSLLPQQWIQVSIPL
DKLESKPGVEYFVNFEVVQKEAQSLVPAGHIVAIEQFKLPITSPKQTYSEKNNYPALKVN
DTEKSISISSTVVKFEFDKSKGIVTSYKVGKNEYFKDGFGIQPNFWRGPNDNDYGNGAPQ
RLQVWKQSSKNFNVIETKVSPEGDNFIVDVTYLLAAGNLYNVKYKILPSGILNVNVLFHS
TDVEEKSIEASEAAITATFSPEASAARKASSSLTVPRIGVRFRLPATMNNVEYFGKGPGE
NYVDRASGSKVGRYKTTADDMYVAYTRPQENGHRTDTRWVSLTGKNNGLLVVADNTIGFN
ALRNSVEDFDSEEATHRPYQWNNFSSEEIASREDENARNRKPRQTHINDITPQDFVEVCI
DMKQHGVAGYNSWGARPLPEYSIPANKNYSWGFTLIPISEKSDINSLTKLNY

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	64	969	3.6e-199	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	41	1115	25	1024	beta-galactosidase.
PRK10340	ebgA	0.0	38	1132	4	1013	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	2.37e-140	69	973	6	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	5.06e-92	793	1115	5	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	6.17e-88	380	662	5	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEA16970.1	0.0	1	1132	1	1132
SCD18882.1	0.0	20	1132	19	1132
BBD44062.1	0.0	29	1132	2	1105
SCM55336.1	0.0	20	1132	19	1131
QRX62653.1	0.0	29	1132	3	1106

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.11e-211	36	1115	1	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.15e-211	36	1115	2	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	3.21e-199	36	1120	5	999	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	4.24e-191	30	1120	2	1003	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	9.28e-144	38	998	16	942	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.28e-211	36	1115	2	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	4.66e-202	24	1118	6	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q9K9C6	5.23e-166	39	1115	11	1011	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
P81650	2.09e-164	31	1115	11	1033	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
A5F5U6	3.30e-161	38	1115	13	1016	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000273	0.999062	0.000172	0.000170	0.000160	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_02120.