CAZyme Information: MGYG000001503_02171

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_02171
• CAZy Family: GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1010	MGYG000001503_2|CGC27	113161.67	5.5316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1412687; End: 1415719 Strand: +

Full Sequence      

MIDIKGKIRLLICGLSLFTISLQGQTVNTKSVYDSKPVDSDAYYFTPENYDFKLDGKSDV
SDALQKAINQVKVEKNFGVLFIPEGKYKISKTIYIPPAIRLIGYGKERPEFILSKNTPGF
QKLDTSDNFNSYSYMFWFTGNLVTEKSRPSDATAGTFYSGISNINFKIEDGNPNAIALRA
HFAQHGFVSHSVINTGKGKAGMYDVGNEMENVYFIGGEYGVMANRTSPGWPMMMIDLLFE
GQLNAAILANQSDLTIVNMEVKNTPVAIEMKEGVYNRIYIEDSYFVNVNRGVVVGADYNA
HNQLNIVNTYCNNVKVAVDLVNEEDVVSKNTRNFLIQNLTSGLIVNNLNDDSKYQTVYNI
VTSQKRSNNIQMKIPTLPSVKEWVNIKDLGAKGDGTSDDTEIIKNAIASYQNLYFPTGWY
RITETIKMLPNTALIGLHPFATQIIIDESTPAFSGFGSPVPMVESSEGGDNIINGIGITT
GGYNYRAVGIKWMAGEKSFMNDIKFVGGHGTMRKPISNTAGQQPGAFRNPVGRNISSPSN
PVAVQGLDLAWDNQYWSLWVTNEGGGIFKDIWTANTYASAGFYVSSTSTPGYVYAMSLEH
HVRFECRLDNVSNWRFYAFQFEEEGREGKDSQPMEMSNCSDLMFANTWFYRVIRVNTPRH
YGIKMSDCHNIDFRNMRNWTQVLYPTELTVYDMNKNLSLYPMDFARAIITGDEVGKKLNN
IIGVPEKLAFGFEFATGAVSDSKGNIYFCENRLKKIYKYDAETGNVSLYSDYPWKPFSLA
VDTQDNLIVICRYDPQPGYLVNGVQEAITERLPDDNPMYSGWGNSGWAALAYSISPDKPG
DMKVLSRVNTSDVKDIKRVVYPTHRWRSNFDTVAQSMPETSFLAPDGITIIPETYDLGRS
VQLFAVSPSQKTAVYMSHEDSKTTAKLSVDDRGKLTILNKDIKRGEYASSTSSDGTLYLA
EGQIFVFDSDGNEIKRYNVDERPISMVIGGDNEDILYYTTSTSFYRLRIK

Enzyme Prediction     

No EC number prediction in MGYG000001503_02171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	47	630	4.4e-83	0.7864864864864864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12708	Pectate_lyase_3	1.50e-11	55	269	12	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam12708	Pectate_lyase_3	7.08e-10	383	492	1	121	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
COG3386	YvrE	2.14e-04	744	1003	37	277	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].
COG5434	Pgu1	5.88e-04	384	511	83	208	Polygalacturonase [Carbohydrate transport and metabolism].
cd05819	NHL	0.009	722	789	138	211	NHL repeat unit of beta-propeller proteins. The NHL(NCL-1, HT2A and LIN-41)-repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures. The repeats have a catalytic activity in Peptidyl-glycine alpha-amidating monooxygenase; proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localized to the repeats. Tripartite motif-containing protein 32 interacts with the activation domain of Tat. This interaction is mediated by the NHL repeats.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA08652.1	0.0	26	1009	17	984
QUT68913.1	0.0	31	1010	30	1000
QUT62546.1	0.0	31	1010	30	1000
BBK89257.1	0.0	31	1010	24	994
QQA31096.1	0.0	31	1010	30	1000

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	3.19e-14	48	613	53	630	ChainA, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	5.38e-09	79	470	71	470	ChainA, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	1.37e-06	369	453	62	158	ChainA, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49426	1.96e-09	22	671	45	703	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004900	0.969682	0.024543	0.000323	0.000271	0.000259

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_02171.