CAZyme Information: MGYG000001503_02349

Basic Information

• Species: Fermentimonas caenicola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Fermentimonas; Fermentimonas caenicola
• CAZyme ID: MGYG000001503_02349
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517		59416.86	9.9491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001503	2824716	Isolate	not provided	not provided

• Gene Location: Start: 1614126; End: 1615679 Strand: +

Full Sequence      

MLYISLRKYDVGGNAKRRHNKTMKNELDGYVIYCKDSDRETPLGVVSDSYDCKAISDYVP
TRLKNFLVEIEDRRFYSHNGIDFKGVSRALVENLKAGRIVQGGSTISQQLARNIIRDTRK
TVTRKLKETIKAVQIEKQYSKDEILNLYFNNVYFGKNIWGLRTAGLYYFGKEVEKLTQTE
LLYLLTILRGPNYYSKRPEITQKRYKTLNSILLDRKVISKNRFQKNLNSKLTVSETQLSS
FKNTAIPFIANRIDDKRKTIISSIDFKTQEFARKFVSESKYPVSIVALRKGKIVGFASSY
GTDYPFISKSNVGSTLKPFLYCHLRESGISEFEKFDALKNNLYWEVREVGYYKSQLNIQE
ALFYSNNNSFLNAASKVGFETNLKFLSDIFNKPETDFFPSSILGATKSGISLYELALAYS
SYFNSTSLTDTKTECLSILNKVFYEKLGLRIENAFLKTGTTNDNKERFAVLGNADLVYAI
LRNENELNDLSKEGSFMNQISRNVSSMFKPDTNFVWI

Enzyme Prediction     

No EC number prediction in MGYG000001503_02349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	57	204	1.8e-53	0.8418079096045198

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	2.62e-67	57	513	82	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.71e-65	59	424	10	408	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	9.18e-62	59	207	21	171	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	3.39e-49	59	234	75	252	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	1.86e-44	59	419	41	426	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB48010.1	1.96e-178	25	508	2	485
APA93463.1	6.20e-177	23	517	1	494
SQH73361.1	2.10e-175	25	508	2	485
BCA51624.1	1.79e-154	25	517	5	500
ABS50914.1	5.86e-103	23	509	1	495

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.48e-29	57	228	26	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	5.32e-29	57	228	26	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.53e-27	56	196	62	199	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.62e-27	56	196	26	163	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.66e-27	56	196	27	164	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.45e-36	59	430	75	478	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
O66874	7.31e-31	57	310	69	317	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P45345	4.77e-30	19	424	133	584	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
P70997	9.40e-30	55	367	79	427	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
O86088	3.78e-29	55	231	73	250	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001503_02349.