CAZyme Information: MGYG000001505_00491

Basic Information

• Species: Kallipyga gabonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Kallipyga; Kallipyga gabonensis
• CAZyme ID: MGYG000001505_00491
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000001505_2|CGC2	40495.36	9.0882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001505	1621211	Isolate	not provided	not provided

• Gene Location: Start: 214863; End: 215957 Strand: -

Full Sequence      

MNKKIILTGGGTAGHVSVNLGLIPRLSREGWTIDYVGSEEGIERDLVSDFPQVTYHAIST
GKFRRRRNWENIKANIGDVGHVFSGIKEAKTLVKKIKPNIVFSKGGFVSVPVVFAASRLG
VPVIAHESDLTPGLANKLSAPFSRKILTTFEKTLDYLPKNKGLYLGPIIRDQIKEGSREK
GLEIFGFDGNKPILLILGGSSGAVRVNEAIWANLDSLLNTFDILHGVGKGKGREELNRPG
YRQVEFIREDMNHALAMADLIISRAGSNAIFEFLYYRKPMVLVPYRLGSRGDQVDNAQVF
VDRGFALSLNDQTMSRDDFLEGVNEVWIKREDFIRAQSDFAFEDGLGKICQILDEDQMPY
SSRS

Enzyme Prediction     

No EC number prediction in MGYG000001505_00491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	194	332	2.4e-33	0.8853503184713376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	6.36e-118	2	355	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	1.07e-111	2	332	1	327	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
COG0707	MurG	2.10e-94	3	326	1	321	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	4.25e-92	4	352	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	2.51e-71	3	307	1	299	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHA92892.1	6.61e-120	1	349	1	346
AUS07792.1	5.36e-119	1	355	1	352
QTC43201.1	1.47e-116	1	336	1	334
QHA36618.1	5.91e-116	1	339	1	337
QWC21367.1	1.19e-115	1	336	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.25e-29	3	317	7	313	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	5.33e-26	1	341	1	335	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	2.10e-20	3	315	10	322	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5D4C2	2.42e-111	1	355	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus sp. (strain WCH70) OX=471223 GN=murG PE=3 SV=1
Q8CUL4	5.55e-110	2	354	4	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831) OX=221109 GN=murG PE=3 SV=1
Q5L3H6	4.48e-109	1	355	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus kaustophilus (strain HTA426) OX=235909 GN=murG PE=3 SV=1
B9DNZ7	1.71e-107	4	349	3	350	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=murG PE=3 SV=1
Q2FYL5	2.83e-107	4	340	3	337	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001505_00491.