CAZyme Information: MGYG000001507_00843

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_00843
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000001507_1|CGC15	39010.04	5.0429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 894849; End: 895871 Strand: +

Full Sequence      

MMAQPNSGLPALHEVFRDAFKIGAAVSMDVLSGQASFITEHFNSITAENVMKPEEVQPQE
GIYTFDAADRIFEFAEANHIAVRGHTLLWHNQTGDWMFRNSEGGPCTRDQLLGRLRTHIN
TVVGRYRGKAYAWDVVNEAVEDKSGQYLRNTKWLEILGEDYLREAFEMAHQADPDALLFY
NDYNETDPVKRDKIYKLVRNLLDQNTPIHGIGMQAHWNIYGPTIGEIRSALELYASLGLR
IHITELDLSMFRFEDERADLKAPTVEMLKLQEERYAEIFAVLLEYRKVIDSVTFWGVADD
YTWLDDFPVRGRKNWPFLFDVNHQPKASFGRIADLAASKG

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	12	334	2.6e-110	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	8.05e-128	12	334	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	3.25e-127	51	332	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	4.25e-101	23	339	39	344	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF47642.1	5.41e-252	2	340	1	339
AIQ70216.1	3.11e-226	2	339	1	338
AIQ17578.1	1.31e-225	1	339	1	339
QQZ61092.1	1.55e-212	2	339	1	338
QUL57134.1	6.95e-207	2	339	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EMC_A	5.58e-159	6	332	1	327	Crystalstructure of XynB, an intracellular xylanase from Paenibacillus barcinonensis [Paenibacillus barcinonensis],3EMQ_A Crystal structure of xilanase XynB from Paenibacillus barcelonensis complexed with an inhibitor [Paenibacillus barcinonensis],3EMZ_A Crystal structure of xylanase XynB from Paenibacillus barcinonensis complexed with a conduramine derivative [Paenibacillus barcinonensis]
2Q8X_A	2.31e-146	6	335	2	331	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	3.28e-146	6	335	2	331	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	1.88e-145	6	335	2	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	2.67e-145	6	335	2	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69231	3.17e-158	6	332	2	328	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	8.88e-141	7	335	3	330	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P23556	2.90e-120	11	332	16	339	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	3.77e-113	9	332	32	349	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	1.89e-98	3	334	36	371	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_00843.