CAZyme Information: MGYG000001507_01685

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_01685
• CAZy Family: CBM3
• CAZyme Description: Xyloglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181		18934.9	4.4382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 1825246; End: 1825791 Strand: +

Full Sequence      

MGTTTLTFSFSAGSAQSLAVAVVDTTTAAPGVLKVQMYNSSTAAAANTLSPRIKLVNTGT
NAVSLADVKLRYYYTIDGDQPQSFFCDWSQVGSANVTGSFVKLTAAKTGADYYLELGFTS
SAGSLAAGASLDIQMRASKSDWSNYTQTGDYSYNAAGTSYADWANLPAYLSGSLVWGNEP
S

Enzyme Prediction     

EC	3.2.1.151

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM3	36	117	5.3e-28	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00942	CBM_3	1.00e-27	35	116	1	82	Cellulose binding domain.
smart01067	CBM_3	1.04e-21	35	117	1	83	Cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ29245.1	2.15e-97	1	181	1042	1222
AIQ58082.1	5.72e-97	1	181	1042	1222
AIQ41034.1	2.89e-95	1	181	1043	1223
CQR55184.1	5.16e-87	1	181	948	1128
QUL57309.1	6.95e-87	1	181	945	1125

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZQW_A	2.33e-59	33	180	6	153	ChainA, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus],3ZU8_A Chain A, Cellulosomal Scaffoldin [Acetivibrio cellulolyticus],3ZUC_A Chain A, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus]
6D5B_A	9.42e-48	31	181	17	168	Structureof Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_B Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_C Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_D Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_E Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_F Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_G Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_H Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_I Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_J Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_K Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_L Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
4B97_A	1.21e-46	31	180	2	151	ChainA, Cellulose Binding Domain-containing Protein [Acetivibrio thermocellus ATCC 27405]
4JO5_A	2.07e-43	31	180	17	172	ChainA, Cellulosome anchoring protein cohesin region [Acetivibrio thermocellus YS]
1NBC_A	2.07e-43	33	180	2	155	ChainA, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus],1NBC_B Chain B, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MUH7	2.77e-59	2	180	847	1027	Xyloglucanase OS=Paenibacillus sp. OX=58172 GN=xeg74 PE=1 SV=1
P50900	2.65e-56	2	180	727	914	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
P23659	1.33e-50	1	180	808	986	Endoglucanase Z OS=Thermoclostridium stercorarium OX=1510 GN=celZ PE=1 SV=1
Q02934	3.42e-46	31	180	738	887	Endoglucanase 1 OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celI PE=1 SV=2
P22533	1.12e-41	26	181	360	516	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999708	0.000355	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_01685.