CAZyme Information: MGYG000001507_02867

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_02867
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240		27302.3	5.8481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3031051; End: 3031773 Strand: -

Full Sequence      

MARVLFINGGSEGHINPTIGVVQELISRGEEVVYFCIEAFRERMEKTGASVRTFDGQRLI
KAFISGGRNYVLERVNGLLLTADIIIPSVLEQIEGEHFDYIIHDSMFGCGHLLAHILKLP
AVNSSTSFVQTKDSFDKMLEPLFTEVSPEIAEPIKHKFNSLTAMMKEKYDVEIHSPYEVF
CNPAPLTIVFTTREFQPDEEAFDQTYKFVGPCITSGFTQETFVSCNRGKRPYLHFTRYRI

Enzyme Prediction     

EC	2.4.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	9.08e-48	7	213	1	209	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	3.47e-19	2	216	1	223	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	1.15e-17	1	214	1	219	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
pfam03033	Glyco_transf_28	6.76e-04	4	87	1	86	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
cd03785	GT28_MurG	0.002	3	47	1	42	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AET61905.1	3.53e-129	1	231	1	232
AYB38258.1	1.43e-128	1	231	1	232
ATO51495.1	1.43e-128	1	231	1	232
ASR46629.1	4.70e-127	1	231	1	232
QDX94197.1	9.45e-127	1	231	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M83_A	3.68e-13	2	212	8	215	Ensemblerefinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
6KQW_A	6.30e-13	3	213	5	204	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	6.39e-13	3	213	5	204	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
4M60_A	1.24e-12	2	212	11	218	Crystalstructure of macrolide glycosyltransferases OleD [Streptomyces antibioticus],4M7P_A Ensemble refinement of protein crystal structure of macrolide glycosyltransferases OleD [Streptomyces antibioticus]
2IYF_A	1.67e-12	2	212	8	215	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	1.28e-31	1	214	1	215	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O05496	5.18e-24	1	211	1	206	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q65JC2	9.09e-16	3	220	5	214	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O34539	3.50e-12	3	213	5	204	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q9XC67	3.26e-11	1	212	58	275	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_02867.