CAZyme Information: MGYG000001507_03065

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03065
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000001507_1|CGC44	34221.01	4.6081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3222849; End: 3223772 Strand: -

Full Sequence      

MRTIWVSKSGGGDFTSVQAAINSIPETADETVLFIEPGVYQEKLRIHKPDLRLYGVGEVR
LVYDDYAPKPNSDGAPMGTFASCSTYITGDNIRVENIIFENTAGESGKVGQAVALYVDAD
KAVFKNCSFLAAQDTLYLAKPKEEKQNRSGRNYFEHCRIAGDIDFIFGSATAYFEECEII
SLNVQKEINGYITAAATPEDKEAGFVFHRCRLVSDAAANSVYLGRPWRDYAQTVFIDCWM
GGHIRREGWDDWGKPSVNHTVYYAEYGNNGPGADTDARVSWSKQLQEQEAGRFTLEDVFG
GDTDWTR

Enzyme Prediction     

No EC number prediction in MGYG000001507_03065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	299	6.5e-98	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.05e-77	11	301	91	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	2.01e-73	2	307	69	368	pectinesterase family protein
pfam01095	Pectinesterase	2.53e-70	6	302	4	298	Pectinesterase.
PLN02773	PLN02773	1.60e-65	2	307	5	304	pectinesterase
PLN02432	PLN02432	3.25e-65	4	307	13	293	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ47910.1	2.36e-172	6	305	3	303
AIQ53381.1	5.28e-169	6	307	3	305
AWB45501.1	6.67e-139	2	305	6	310
AGX04063.1	4.74e-109	6	307	3	321
AGF58031.1	2.02e-103	4	305	2	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.29e-42	6	281	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.45e-41	6	281	11	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	1.19e-35	7	306	11	338	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	2.07e-32	12	278	17	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	2.67e-32	11	305	41	361	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.25e-54	2	293	5	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	8.95e-54	2	307	80	379	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9SIJ9	7.48e-52	4	307	51	333	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9ZQA4	1.41e-50	6	305	44	332	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1
Q8VYZ3	1.72e-50	8	307	90	382	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03065.