CAZyme Information: MGYG000001507_03103

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03103
• CAZy Family: CBM50
• CAZyme Description: Protein TolB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000001507_1|CGC45	51103.39	5.402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3258586; End: 3259956 Strand: -

Full Sequence      

MAVQAVSHNPVQGWIAYTSDRGGTFDIWVYRPQDGLNFQLTHGLGAEFSIPYWSPDSRRI
AFIGIGNVVHLLDTLTLTVARIDQVEQYTLLDWSPDSRFLVYVKNGRIIIYNTFSHNSYT
ITEPGAGDVQWFPSGRELLFSAPDSSGNTQLFRIGTDGTNRRQITQNTDGPLHNVRISPD
GTFALYTFPGESISIISTVDLATGTIYTLEGGPLAKNYFLVWSPDSRSIAYSATAYQEPN
YYSLIQIDSRTGKNQRTLSASSCFATPVSWSPGGDKIAYLSGCSDVESASQLWITDLKEQ
IPVNVLSGGRITALQWSPRVRRILEAIYTNYVYRVSFPYPAYWHRVSEERYEGSDGFFQV
SAISAGDRIADVCNSEAFHPLMPYGSSPKIVMMTIQNQEACFIFPSADQPPEMNQQAALI
VRYPRPVQIGETFYNYFILWADENHIRQIGGRLAFL

Enzyme Prediction     

No EC number prediction in MGYG000001507_03103.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03629	tolB	8.58e-11	51	272	204	427	Tol-Pal system protein TolB.
COG0823	TolB	7.25e-10	14	272	206	423	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
COG0823	TolB	1.03e-09	116	324	139	341	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
COG2319	WD40	1.42e-09	2	285	157	433	WD40 repeat [General function prediction only].
sd00039	7WD40	3.24e-09	88	326	1	236	WD40 repeats in seven bladed beta propellers. The WD40 repeat is found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing, and cytoskeleton assembly. It typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40. Between the GH and WD dipeptides lies a conserved core. It forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel beta-sheet. The WD40 sequence repeat originally described in literature forms the first three strands of one blade and the last strand in the next blade. The C-terminal WD40 repeat completes the blade structure of the N-terminal WD40 repeat to create the closed ring propeller-structure. The residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands, allowing them to bind either stably or reversibly.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOK29155.1	5.89e-183	12	456	158	605
AND40662.1	3.36e-182	12	456	158	605
QGH33144.1	4.10e-178	12	456	158	604
AYA74756.1	1.42e-173	13	456	159	604
QBP40070.1	2.42e-169	12	455	158	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03103.