CAZyme Information: MGYG000001507_03655

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_03655
• CAZy Family: CE12
• CAZyme Description: Acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		27391.98	4.6852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 3784642; End: 3785406 Strand: +

Full Sequence      

MLQVCLEGDGAAPEESGVSILSLYPLPVQEERPFILVLPGGGYHHLARHEGEPVAQWLNS
LGIHAGVLKYRTQDIDPSLLIKDVEEALAWVREAPMEWNVRTGQIGLAGFSAGGHLAAIT
AATTAAESKPDLLLLGYPVITFEEPYAHAGSRLNLLGANPVGASLVAYSADRQVDSRTPP
AFIWATANDASVPVENSLKFAAALSESGIPFELHIFEEGRHGLGLSAGNEECRQWLQLCA
AWLKKHHYVTEEEA

Enzyme Prediction     

No EC number prediction in MGYG000001507_03655.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0657	Aes	1.51e-17	25	241	72	306	Acetyl esterase/lipase [Lipid transport and metabolism].
COG1506	DAP2	2.58e-12	81	246	454	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	6.28e-08	83	246	44	209	Prolyl oligopeptidase family.
pfam07859	Abhydrolase_3	5.61e-05	81	222	49	206	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.
COG0412	DLH	0.003	75	222	87	202	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR46787.1	3.70e-104	19	253	21	253
AWV32848.1	1.48e-103	19	253	21	253
ALP38419.1	5.04e-102	1	251	1	251
AET61722.1	6.72e-102	1	251	1	251
QNR65956.1	1.52e-100	1	253	1	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6A6O_A	2.51e-61	13	249	35	282	ChainA, Esterase/lipase-like protein [Caldicellulosiruptor lactoaceticus 6A]
7DWC_A	2.10e-30	35	245	55	263	ChainA, Xylanase [Bacteroides thetaiotaomicron VPI-5482],7DWC_B Chain B, Xylanase [Bacteroides thetaiotaomicron VPI-5482],7DWC_C Chain C, Xylanase [Bacteroides thetaiotaomicron VPI-5482],7DWC_D Chain D, Xylanase [Bacteroides thetaiotaomicron VPI-5482]
3HXK_A	7.48e-30	33	245	44	264	CrystalStructure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108 [Lactococcus lactis subsp. lactis],3HXK_B Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108 [Lactococcus lactis subsp. lactis],3HXK_C Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108 [Lactococcus lactis subsp. lactis],3HXK_D Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108 [Lactococcus lactis subsp. lactis]
3BJR_A	1.21e-29	29	243	47	279	ChainA, Putative carboxylesterase [Lactiplantibacillus plantarum WCFS1]
4Q3K_A	2.26e-27	31	245	53	256	Crystalstructure of MGS-M1, an alpha/beta hydrolase enzyme from a Medee basin deep-sea metagenome library [unidentified],4Q3K_B Crystal structure of MGS-M1, an alpha/beta hydrolase enzyme from a Medee basin deep-sea metagenome library [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	1.78e-33	31	231	401	613	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
D5EV35	9.13e-31	26	244	41	264	Acetylxylan esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axeA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_03655.