CAZyme Information: MGYG000001507_04021

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_04021
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000001507_1|CGC58	28025.88	4.4373

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 4164229; End: 4164981 Strand: +

Full Sequence      

MIRSRLIKTSAAVAALSAAVWGIWAFTSASSSEAGSVKDKFTTFNSEFWKKTDGYSNGDM
FNCTWREDNVSFAGDDLMTLSLTSPSPGEFDGAEYRSLDKYGYGRYEIRMKPAANPGVVS
SFFTYTGPSEGEPWDEIDIEFLGKNTRQVQLNYFTDGAGGHEQVIDLGFDASQEFHWYGF
DWKRDSITWYIDGRPVHTATANIPSTAGRIMMNLWNGTGVDSWLEPFDGKVPLHAYYDQF
RYTPDQASGE

Enzyme Prediction     

No EC number prediction in MGYG000001507_04021.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	39	239	3.1e-87	0.9854368932038835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02175	GH16_lichenase	2.09e-108	39	244	3	212	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
pfam00722	Glyco_hydro_16	5.75e-47	65	229	1	161	Glycosyl hydrolases family 16.
COG2273	BglS	1.00e-46	34	248	44	271	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd00413	Glyco_hydrolase_16	6.17e-46	39	243	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02176	GH16_XET	1.43e-27	61	240	10	198	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF47917.1	3.90e-178	10	250	2	243
AIQ31819.1	7.95e-168	2	250	1	249
AIQ19992.1	1.28e-165	8	250	2	244
AIQ43120.1	4.57e-161	16	250	1	233
QSF43970.1	5.47e-106	39	243	34	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O5S_A	3.37e-103	29	243	22	236	CrystalStructure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1BYH_A	1.62e-100	35	243	4	212	MOLECULARAND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1GBG_A	1.33e-99	35	243	4	212	BacillusLicheniformis Beta-Glucanase [Bacillus licheniformis]
1U0A_A	1.33e-99	35	243	4	212	ChainA, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]
1MAC_A	2.04e-98	44	243	11	210	CrystalStructure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04957	1.05e-102	29	243	26	240	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2
P45797	4.30e-101	44	243	37	236	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
P07980	1.27e-100	27	242	21	236	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
P23904	9.15e-98	34	243	25	235	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
P27051	3.70e-96	28	243	26	241	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.596747	0.391874	0.007997	0.001603	0.000659	0.001112

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_04021.