CAZyme Information: MGYG000001507_04152

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_04152
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300	MGYG000001507_2|CGC2	34675.93	5.1055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 29337; End: 30239 Strand: -

Full Sequence      

MDSYEDKRLNFSFYSGEDLYSDGEIEDEMLEIAKNNTDFDNIIANDNRWPILYHFSSKRH
NLLEWYPFDKGAEVLEIGAGCGAITGVLCDKCKHVTSVELSKKRSLINYHRNRDKQNLEI
IVGNLNDIEFDKKFDYITLIGVLEYAAMYTISNSPYNDFLKNIKKNLKPNGTLIIAIENK
FGLKYWAGSKEDHTGVLFDGLENYPSNRQVSTFSKSELTTKLLDAGFKENRFYYPYPDYK
LPNSIYSDGRLPKIGELQNNLVNYDQSRTILFSEQAVYNSILHSEGEYPFFSNSFLVFSK

Enzyme Prediction     

No EC number prediction in MGYG000001507_04152.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02440	AdoMet_MTases	1.64e-12	74	178	2	105	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
pfam13649	Methyltransf_25	1.12e-11	74	171	1	97	Methyltransferase domain. This family appears to be a methyltransferase domain.
pfam08241	Methyltransf_11	7.09e-11	75	175	1	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam08242	Methyltransf_12	3.81e-09	75	173	1	98	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
PRK14896	ksgA	4.53e-09	74	156	33	101	16S ribosomal RNA methyltransferase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHC23007.2	7.33e-136	8	298	9	298
QNM10216.1	4.28e-92	9	297	4	290
CBL21588.1	2.70e-86	9	297	4	290
QCU01345.1	2.19e-85	9	297	4	290
AFZ48015.1	1.88e-56	20	300	35	333

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_04152.