CAZyme Information: MGYG000001507_04865

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_04865
• CAZy Family: GT2
• CAZyme Description: Dimodular nonribosomal peptide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1122	MGYG000001507_3|CGC3	126333.44	5.8118

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 168338; End: 171706 Strand: -

Full Sequence      

MEQTLERTQKLQLAEAILRHKLGLTGDSFPASKGQEGLFLQYRLAPDSCAYHLNFCARID
NQIRVDLLRESFRILRDKHPILRTGYRENGGGLFKVVQQVMTGEEFWTVHEVSDLEEEMI
EPLVHECSRHPFDLENGKVMRVDFFERAGGQGILLISIHHIAMDYWSQGILLNELGLIYT
SLVEHGTASPGPSGVLYSEFAKWQGGLLTSKEGRRSLDYWKETLNGLLPCMDLPTDYPRG
EYADYRGHSCSFELNPKMVDGIRRLAGAHGATVYVIMLAFYYMLLQKYSGQRDIIIGSPT
TGRSSARFKDTIGYLVNMLPLRIDADSSLSFPELVAYVKQVSMEGLIHGDIPFFNIVREL
QGQRNGNRTPVFQVSLTFEKPTSANRSGRFLFTEERPLIQLGCLILQPVPVSVHASQYEL
SLYLEEVEGSLSGQFHYQSALFKEETIQRMALHYVQLISEVLDKPDLEIGAYPIITKEER
ERILNVWNSPAAKFTEEETLHSQVGKMAARFPTRTAVVCGQEEITYSELHLKSSILATCL
NAKGVGPEVKVPLIVQPSLDMIVAILAVLKAGGTYVPIHHQAPPERIAEIIQDIQPAVII
TERDLAAKIQGGETDILYVDGDWRVPESAEILESNQDVTAENTAYIIYTSGSTGKPKGVM
VSHRNAVRLFTSTKPWYNFDERDTWTLFHSFSFDFSVWEIFGALLYGGKLVIVPYYVTRE
PHAFYRLLSSEGVTVLNQTPSAFKQLMNVDLSLHQEYPLALRVVIFGGEALDLKSLRPWF
ERHGDKEPTLVNMYGITETTVHVTYRPITMADTEFATGSFIGEPIPDLQIYLLDEYQNLV
SPGVYGEIYVGGAGVSKGYFNRPELTAEKFLDDFIGGIPGNRLYRSGDMGRYLPNGDIEY
LGRRDSQVKIRGFRIELGEIRSKILDFTGIKDAVVLVEGSRDEDKRIVAYVVLHYQELFD
SGTLRKFLKGKLPDYMIPSAFLAVEQIPLNANGKIDRSALPPVVCGILESSSFSAPETEL
QRKLACLWGEVLSMDKVGIDHPFFDMGGNSILMVELHNRIKDQLCADISIADLFQYSTVA
EQAQHIESIQSKHKDDKTSSVTADRIDKQQLRKHAMNRRVKP

Enzyme Prediction     

No EC number prediction in MGYG000001507_04865.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12467	PRK12467	0.0	26	1090	47	1101	peptide synthase; Provisional
cd05930	A_NRPS	0.0	512	1000	1	444	The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
PRK12316	PRK12316	0.0	27	1084	48	1082	peptide synthase; Provisional
PRK05691	PRK05691	0.0	26	1110	673	1727	peptide synthase; Validated
PRK12316	PRK12316	0.0	22	1096	4096	5149	peptide synthase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ75991.1	3.28e-226	216	1084	315	1176
BAZ00088.1	3.28e-226	216	1084	315	1176
BAY90071.1	2.05e-225	216	1084	314	1175
BAY30132.1	1.24e-221	216	1084	315	1178
QND46664.1	2.18e-165	30	1092	1616	2668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P1J_A	1.29e-168	27	1000	4	964	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]
6MFZ_A	2.21e-147	29	1090	786	1801	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
6N8E_A	1.07e-142	27	1086	28	1066	Crystalstructure of holo-ObiF1, a five domain nonribosomal peptide synthetase from Burkholderia diffusa [Burkholderia diffusa]
6OYF_A	1.34e-142	30	912	4	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module [Eleftheria terrae],6OZV_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with AMP [Eleftheria terrae],6P4U_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg and AMP [Eleftheria terrae]
4ZXH_A	1.50e-139	32	1079	20	1037	ChainA, ABBFA_003403 [Acinetobacter baumannii AB307-0294],4ZXI_A Chain A, Tyrocidine synthetase 3 [Acinetobacter baumannii AB307-0294]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45745	6.61e-222	27	1087	1049	2108	Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbF PE=1 SV=4
P39846	2.03e-195	27	1086	1054	2076	Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsB PE=1 SV=1
Q70LM5	1.47e-188	30	1081	6237	7265	Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis OX=54914 GN=lgrC PE=3 SV=1
Q70LM6	1.77e-186	30	1084	3634	4669	Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis OX=54914 GN=lgrB PE=1 SV=1
Q70LM4	1.36e-181	27	1089	3637	4675	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
265	284