CAZyme Information: MGYG000001507_04912

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_04912
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174		19438.59	9.3878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 216958; End: 217482 Strand: -

Full Sequence      

MADKATIVLFSHVSNTRSITGAEKLLLFFARELSSYFNCILVAPQDGKLTRKARSSGLSV
QVIPIPLVYGMYTPYAGLEADIRKLQESREYRELTDWLAALRPALIISSTCVHALPAMAA
KSLGIPVVWKISETITDNDYTGISVELIHRNSDEILAISQTQRLVFRWISVRAR

Enzyme Prediction     

No EC number prediction in MGYG000001507_04912.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	0.004	7	168	2	161	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
pfam13579	Glyco_trans_4_4	0.009	41	174	23	150	Glycosyl transferase 4-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSF44216.1	3.45e-103	1	166	1	166
AWV35602.1	8.15e-90	1	166	1	166
QQZ61714.1	1.44e-89	1	166	1	166
CQR57966.1	1.44e-89	1	166	1	166
QUL53990.1	2.46e-84	1	166	1	166

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_04912.