CAZyme Information: MGYG000001507_05059

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_05059
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001507_3|CGC8	41909.63	4.8161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 363412; End: 364527 Strand: -

Full Sequence      

MIGSLSKTPMEWARKACDSLMDTYQAGELPPAHRWHYHQGVFLCGMELLWQAAGEERYIE
YIQAYVDDLVDEYGNLYFARDELDAVQAGLLLFTLHERTGKEKYKIAAEKLRNLLLTVNR
TSEGGYWHKDKYPYQMWLDGLYMAGVFSLKYANAYGEVELRQSVLHQEKLMRKYMKDEAT
GLLYHAWDESRRMPWADKETGCSPEFWSRSLGWYGLALSQFLDLLPAEEPGQPELAAALS
EFVQALIRYQDPVSGLWYQVVDKGAEPDNWLETSGSCLFVYTIAKAVKLGLTSDEAGAVL
AARKGYEGLIRVLQQDEQGRLILPDICIGTSAGDYENYVTRPKVSNDLHGVGALVMACVE
IQSLYGAGSKS

Enzyme Prediction     

No EC number prediction in MGYG000001507_05059.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	30	361	2.8e-102	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.29e-130	5	365	4	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.48e-117	12	360	1	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04791	LanC_SerThrkinase	0.002	49	146	98	207	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ20362.1	7.35e-249	1	365	1	365
AIQ54723.1	4.01e-246	1	366	1	366
AIQ49239.1	5.47e-243	1	370	1	370
AIQ43588.1	1.96e-238	1	367	1	369
AIQ60782.1	2.29e-237	1	367	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.79e-149	7	370	11	373	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.28e-149	7	370	1	363	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.98e-74	20	364	8	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	6.62e-12	37	360	82	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.83e-149	7	370	11	373	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.86e-29	147	360	5	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.86e-29	147	360	5	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.61e-22	35	289	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001507_05059.