CAZyme Information: MGYG000001507_05221

Basic Information

• Species: Paenibacillus ihuae
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus ihuae
• CAZyme ID: MGYG000001507_05221
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		29277.34	6.4758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001507	6631509	Isolate	not provided	not provided

• Gene Location: Start: 129400; End: 130167 Strand: +

Full Sequence      

MFKKMMKRFSIFGLAAVFVLTFAQSVFASDQPVQLTSANLYLYKYGYVGFSGNIEVSNLG
YQKTVTIHYTPGDGKWYDTNASYQAPTDSTHEKWGFMVSTDIMNNNNPQLTNAQTIQFAI
KYQVNGQTYWDNNNGQNYSVSRFNESSTILGKPQVLRAYDDLYKNTFSGSIYVKNLDYSK
EVKIKYTTDNWNTTREGYASYSMPGNSDGSVEIWNFSFNNIDPSVTQIQYAISYTAIGQT
YWDNNYENNYTVNRY

Enzyme Prediction     

No EC number prediction in MGYG000001507_05221.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	163	252	1.4e-21	0.8598130841121495
CBM21	32	140	5.9e-20	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03370	CBM_21	1.88e-18	164	253	18	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam03370	CBM_21	8.76e-18	31	141	5	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam16760	CBM53	6.08e-04	179	252	9	75	Starch/carbohydrate-binding module (family 53).
pfam16760	CBM53	8.02e-04	111	140	49	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR53753.1	6.70e-165	1	254	1	254
AIQ70729.1	7.81e-164	1	255	1	255
QQZ61948.1	4.32e-161	1	254	1	254
QMV44549.1	4.28e-83	15	253	15	253
ASA23682.1	8.52e-76	3	252	5	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EIB_A	1.15e-11	126	233	2	109	ChainA, Glucoamylase [Rhizopus arrhizus],4EIB_B Chain B, Glucoamylase [Rhizopus arrhizus]
2DJM_A	7.53e-11	165	252	19	104	ChainA, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]
2EEF_A	5.82e-07	162	254	43	137	ChainA, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9VVY3	1.31e-09	158	250	537	629	Glycogen-binding subunit 76A OS=Drosophila melanogaster OX=7227 GN=Gbs-76A PE=1 SV=1
P07683	1.69e-09	165	252	44	129	Glucoamylase 1 OS=Rhizopus oryzae OX=64495 PE=1 SV=2
Q6DDQ5	2.69e-08	162	254	145	239	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus laevis OX=8355 GN=ppp1r3c PE=2 SV=1
Q9UQK1	5.28e-08	162	252	164	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
P40187	5.87e-07	169	252	410	507	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000973	0.997685	0.000397	0.000356	0.000305	0.000256

TMHMM  Annotations     

start	end
9	28