CAZyme Information: MGYG000001509_00148

Basic Information

• Species: Flaviflexus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Flaviflexus; Flaviflexus massiliensis
• CAZyme ID: MGYG000001509_00148
• CAZy Family: GT39
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		73613.63	6.0696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001509	2631133	Isolate	not provided	not provided

• Gene Location: Start: 143984; End: 145963 Strand: -

Full Sequence      

MTVDEENPVKTADRGRTLTERQAAAWERDLLSRLGITWSTLPTQIRLWGWLVTLATGLIA
FLTRFIGLSHPHQMVFDETYYVKGGYSLITHGYERNWVGENADEIFVQGSDVASELAADY
VVHPPFGKWLIGFGQALFGTDNGLGWRFATALAGVISVMLLTRIALHLFRSVPLAFVAGL
FIALDGVGITLSRTGILDNLLATFVLAGFWAVLKDREWTRRRLAHRVAHGRVGAGGEPLS
SLGPVLLWRPWLLLAGAFIGLGCGVKWSAGYALAVFGILVFVWDTAARKEIGARRWFTSG
IITGGIPAFFSFIPIALVAYVGAWTSWFLDPRSFKKGWAESQRVIGEQVPFEGLGDTVAE
WIAYHRQMWEFHTGLDSPHTYMSQPWDWLLQIRPVNFYWPPQEKIVQDCGAERCVQAINS
VGNPAVWWFATASLLVVLWFAFKHGDWRAWAILAGYGAMYLPWFNYIGRTIYQFYSVAFL
PYVVLALVFALAWVSDLLSPPSLSAIRKAVARRRRKELDEDWTLGLPEPKKLATPATYNE
DLGEDSEKTETETLDQDHAPTKEQGPETTVTADSEDRAAPSPEDNAEVAEDPVDRAVLLY
GGPDALPYQLGLPTKKAAIVLGVTSGVVIIFAAFWMPLWTGMTIPYDFWRLHIWLPGWS

Enzyme Prediction     

No EC number prediction in MGYG000001509_00148.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	58	328	3.4e-67	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	4.23e-20	51	313	25	262	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	4.48e-14	57	282	4	198	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam16192	PMT_4TMC	3.59e-13	361	498	3	143	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	5.77e-12	123	492	136	410	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	1.00e-10	120	289	61	201	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZQ77974.1	0.0	1	659	1	743
AZN30659.1	0.0	3	659	81	733
QOR47371.1	1.68e-196	27	658	11	558
QTG75226.1	7.74e-195	27	658	11	558
QOQ38165.1	1.10e-194	27	658	11	558

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	8.15e-69	49	510	37	473	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	6.87e-68	46	510	40	479	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	6.87e-68	46	510	40	479	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	9.15e-59	28	510	8	482	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
Q9W5D4	1.30e-06	48	278	37	239	Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000066	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
46	68
145	167
174	196
251	283
296	318
425	442
449	468
483	505
617	639