CAZyme Information: MGYG000001509_01807

Basic Information

• Species: Flaviflexus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Flaviflexus; Flaviflexus massiliensis
• CAZyme ID: MGYG000001509_01807
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	MGYG000001509_7|CGC5	31416.37	6.696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001509	2631133	Isolate	not provided	not provided

• Gene Location: Start: 1019071; End: 1019937 Strand: +

Full Sequence      

MKISAVVVTYRPGPIGELLHALAKQCDQVIIVDNTPGGDSTLAELSEALGAVLLPLGENM
GIAVAQNVGIDYALKDGADAVLLSDQDSILAGGMVATLAQHLRPGIGAVGPVPVEGTDVL
VYTDHEYGPKRPATLPDTDEIEVSFLLASGCLIPADVLDDVGTMNSALFIDHVDLEWGMR
ARRAGYRLLAIRDAVLEHRLGDSVVKVPGRAQIVHVHGPLRNYYLIRNTIALIKTSLLPI
KWRIRYVYWIVRFAVFNLLVNPDRITRLHYVVRGFNDGWKGRLGRYGN

Enzyme Prediction     

No EC number prediction in MGYG000001509_01807.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02526	GT2_RfbF_like	1.10e-78	5	233	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
TIGR01556	rhamnosyltran	2.19e-67	8	278	1	281	L-rhamnosyltransferase. This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG1216	GT2	2.03e-28	1	254	3	265	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	1.56e-17	5	232	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	2.90e-15	6	199	2	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZN30866.1	2.45e-123	1	287	1	287
QJC21134.1	8.08e-98	3	288	4	289
QCX46044.1	8.99e-97	2	285	4	288
SQH27198.1	2.56e-96	2	285	4	288
ADH91856.1	2.56e-96	2	285	4	288

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37782	1.65e-17	2	284	4	290	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001509_01807.