CAZyme Information: MGYG000001509_02057

Basic Information

• Species: Flaviflexus massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Flaviflexus; Flaviflexus massiliensis
• CAZyme ID: MGYG000001509_02057
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000001509_7|CGC7	38818.34	6.3679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001509	2631133	Isolate	not provided	not provided

• Gene Location: Start: 1269621; End: 1270718 Strand: +

Full Sequence      

MKVLAAAGGTAGHVNPMLATARELTERGHEVLAIGTMEGLEADLVPAAGLELYPIAKIPL
PRKPSLDLVRLPGRMRATVNELRGLMRARSIDAVIGFGGYVSTPAYLAARQEKIPVIIQE
QNARPGLANKLGARWAKGVSLTFETTPLAAKNGITRVTGLPLRKEISDLAADFQVPERRW
ERRNAAAERFGLDPETPIVLVTGGSSGAQRLNVAFSQAATDIRKHAQVLHITGRGKSSDV
DSSSTGEGYRVEEYVGDMEEAYAVADLVVTRSGAGMVAELAALGIPAVVVPLAIGNGEQY
LNAKTYIDAGAFTHIPNDEFTADRVRSEIVPLINPTTLKERRDILLQSGVSNGGSAVADL
VEECA

Enzyme Prediction     

No EC number prediction in MGYG000001509_02057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	199	341	7.2e-40	0.910828025477707

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.73e-121	1	365	2	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.70e-107	2	360	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.99e-95	1	365	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	8.92e-91	1	361	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK12446	PRK12446	4.67e-43	2	306	3	296	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZQ76221.1	6.29e-188	1	363	1	363
AZN28949.1	2.48e-166	1	362	1	362
QOX82579.1	5.13e-122	1	363	1	358
AWG15650.1	4.59e-121	1	360	1	360
AWG04824.1	4.59e-121	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F0K_A	3.28e-48	2	338	8	328	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
3S2U_A	1.72e-41	3	343	5	333	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	4.68e-41	3	363	12	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0JV94	1.40e-91	1	363	6	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Arthrobacter sp. (strain FB24) OX=290399 GN=murG PE=3 SV=1
A1R5F8	3.45e-88	1	363	12	368	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Paenarthrobacter aurescens (strain TC1) OX=290340 GN=murG PE=3 SV=1
B0RIJ3	8.36e-88	4	363	5	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) OX=31964 GN=murG PE=3 SV=1
Q8CY50	1.30e-87	3	333	8	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bifidobacterium longum (strain NCC 2705) OX=206672 GN=murG PE=3 SV=1
B3DQN1	1.30e-87	3	333	8	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bifidobacterium longum (strain DJO10A) OX=205913 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001509_02057.