CAZyme Information: MGYG000001510_00266

Basic Information

• Species: Numidum massiliense
• Lineage: Bacteria; Firmicutes; Bacilli; Thermoactinomycetales; Novibacillaceae; Numidum; Numidum massiliense
• CAZyme ID: MGYG000001510_00266
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000001510_9|CGC2	50042.13	9.7138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001510	3755739	Isolate	not provided	not provided

• Gene Location: Start: 158564; End: 159877 Strand: +

Full Sequence      

MSESRQRVLAYRNEGALPNTKAIDTPLGKVLAATIFAVCVFLMFHVNFRAEKDVDYIFGV
LMSITLAYFLLKMLISFFYTPAKGEPGEHKVSVVVPCYNENTYSVQVMIESLLKQSYPVH
EIIFVDDGSADITTYQAVKKLAEENPKIRCHRFDKNKGKKEGQKWAFERATGDIIMLTDS
DSYISRHAVKEMLRQFRDEKVSSVVGHINARNENDSFITRLQDILYQGAFRVGRGAQSVT
GTVLVCSGALSMHRREVVMDNLDFFMKEKRLGIAIKNGDDRCLTIAALKSGGKTKYQSTA
TAVTDVPEDLTKFFKQQTRWARSFFLYSMVSLKYAWKRPSFLFWLIGEGAMWALFTTSVI
QSLTKVTNLTATNWQMYAYYTICYLILASLNHGLYYIFRNPFRYFLAPLFALAHMAIIFP
VRLYALLTIWKDNWGTR

Enzyme Prediction     

No EC number prediction in MGYG000001510_00266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	92	258	3.3e-34	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.08e-53	57	430	20	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06434	GT2_HAS	1.79e-45	91	327	2	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06423	CESA_like	6.35e-45	93	264	1	172	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.53e-32	92	258	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PRK11204	PRK11204	9.92e-28	90	355	55	302	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCU82867.1	5.36e-131	29	437	23	452
AKO94965.1	4.58e-114	24	437	7	422
QTC43973.1	8.47e-113	42	437	1	394
AZB44972.1	1.82e-108	19	437	2	434
QGQ44308.1	3.69e-106	29	437	29	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.49e-07	91	214	7	127	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C0H1	2.91e-89	30	437	9	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=hasA PE=3 SV=1
P0C0H0	4.10e-89	30	437	9	412	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1
Q8NKX1	4.10e-89	30	437	9	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
Q5X9A9	5.79e-89	30	437	9	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1
P0DB60	5.79e-89	59	437	34	412	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000009	0.000019	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	46
56	78
339	361
376	398
405	427