CAZyme Information: MGYG000001510_02792

Basic Information

• Species: Numidum massiliense
• Lineage: Bacteria; Firmicutes; Bacilli; Thermoactinomycetales; Novibacillaceae; Numidum; Numidum massiliense
• CAZyme ID: MGYG000001510_02792
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000001510_9|CGC23	46010.08	10.4719

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001510	3755739	Isolate	not provided	not provided

• Gene Location: Start: 2899861; End: 2901111 Strand: -

Full Sequence      

MKRSKQTLLLLALICMLLGACRMGGQATRRDQSATPPGQTKTSGQSRVKSNGQKPAKMLG
DEGTNRVGKGTNRVGKGTVRGGKGARIASDKPTIDSIGYLEPTSPTKAPQLVKGVADNLT
YVAMFSYRVQKDGSLIPLKDDTALAATRQSKAKPMLVITNFADGTFSQEVAHAILTDKEA
MNRLIDNVLGVMKSKKYAALNIDFEHIFASDRDRYTEFLKTITPKVKAAGFPVSTALAPK
ISGKQAGPWYSAHDYGAHARIVDFVILMTYEWGWTGGPPMAVAPISQVKNVLDYAVSVIP
REKIVMGAPLYGYDWVLPYKKGGPPAKRIGPQKAAALAEKYGATVNYDRDAQAPFFRYTD
GRGKKHIVWFENDKSMQEKFNLVKKYGLRGVSYWEISESFPNNWRLLRDNFYIRRR

Enzyme Prediction     

No EC number prediction in MGYG000001510_02792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	116	400	2.9e-43	0.8412162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.77e-148	94	407	2	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.35e-120	87	411	95	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	4.90e-34	97	397	3	332	Glyco_18 domain.
cd06549	GH18_trifunctional	7.86e-29	143	404	51	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	7.45e-21	118	397	27	305	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBU39250.1	6.32e-151	88	415	67	394
QKG85080.1	1.11e-149	94	415	65	386
BCU81849.1	1.37e-149	86	415	63	392
ALC81256.1	6.58e-149	93	415	64	386
QYR22662.1	3.41e-146	96	413	67	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	2.33e-98	91	413	102	427	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	4.05e-97	97	416	110	432	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	3.79e-69	104	397	18	309	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	6.83e-30	163	404	73	307	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	2.05e-27	172	394	88	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.19e-100	91	413	100	425	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q9K3E4	4.14e-98	91	413	101	426	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P0DPJ9	1.65e-97	91	413	101	426	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O05495	3.79e-70	88	415	86	419	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	4.98e-41	122	408	55	340	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26