CAZyme Information: MGYG000001511_00846

Basic Information

• Species: Massilibacterium senegalense
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_E; Massilibacteriaceae; Massilibacterium; Massilibacterium senegalense
• CAZyme ID: MGYG000001511_00846
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		24788.4	9.9332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001511	2848543	Isolate	not provided	not provided

• Gene Location: Start: 178496; End: 179185 Strand: -

Full Sequence      

MRVDLMNYFYELTALQQLNQSSPPPSPLAEGDGKSLFSTLLKEQLNDILNQQKPSAPVLA
KQGLYQFAFLDPSKSTLLSSFPASVSQIKAKQPPVATASSGALSSPFDAFIKEASSKFGV
DVNLIKSVIKQESNFNPFAKSGSGASGLMQLMPATARSLGVTDPFDPKQNIEAGTKYLRQ
MLDRFQGNMELALAAYNAGPGNVKKYGGIPPFKETQNYITKILTTLRSL

Enzyme Prediction     

No EC number prediction in MGYG000001511_00846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	121	224	2.3e-35	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	5.07e-57	124	224	3	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.26e-52	106	224	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	7.58e-49	106	223	3	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.14e-43	111	218	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	7.64e-42	111	210	1	113	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA75137.1	1.53e-60	1	226	1	203
QOR67597.1	2.46e-56	1	228	1	203
BAB06571.1	2.99e-56	20	225	15	228
QUF66612.1	4.78e-56	11	222	11	230
QJC88127.1	5.02e-55	11	222	11	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.16e-16	105	223	414	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.18e-16	105	223	418	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.20e-16	105	223	424	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.22e-16	105	223	428	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.24e-16	105	223	434	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.42e-52	108	222	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.08e-44	101	223	1416	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.08e-44	101	223	1416	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	1.70e-20	111	229	11	122	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	8.56e-18	107	204	286	389	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001511_00846.