CAZyme Information: MGYG000001512_00691

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_00691
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000001512_17|CGC4	37207.84	7.6836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 299172; End: 300104 Strand: +

Full Sequence      

MIQKYKEVNDSFSYWKLIFHLGCDSGFYSEFNNMVLAMIYCLKSQIRFSMYSADANFGYK
DGWQDYFLPFCEEVNDKFHHKYNARTENPWFSVHGLARWEYLLWRLKHKHTYLTFDLFCK
FRQVSCARIEYSIPQLELKGDLRTVAHEIIKMIYRFNPETLSEIRKLIQPLDLPDKYIGF
HIRGGDKFTEHELLQCSAYIDKAEKLSLLRKAFVLTDDYRIIETLKQNYPQWRFYSLTES
SERGYFHAKFQSQDKESKKKDLIKLFASMEILRMSELFVGTFSSNVGMFLGMCMEKERAY
GVDFDEWLLW

Enzyme Prediction     

No EC number prediction in MGYG000001512_00691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	16	288	9e-25	0.839622641509434

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11300	Fut8_like	9.61e-12	149	287	158	301	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	1.94e-05	155	288	50	199	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62108.1	1.49e-225	1	310	1	310
SDS80372.1	2.41e-82	3	310	8	311
QED36504.1	1.37e-81	1	310	6	311
ADQ79466.1	5.09e-70	2	303	3	332
QUT49913.1	7.85e-70	3	306	12	327

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000018	0.000006	0.000000	0.000000	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_00691.