CAZyme Information: MGYG000001512_00861

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_00861
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769		88139.94	6.7609

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 532540; End: 534849 Strand: -

Full Sequence      

MSRKIVLVIWGLLSFFFVQADESRARWITAFENQSASNTWLCFRKDIHLNSRPSESVTLK
IAADSKYWMWINGRLAVFEGAVKRGPTPEDTYYDTVDVTSFLQEGKNAVAILLWYFGKEG
FSYQPSGKAGLFVESLSDEFPLYSDKSWFSAIHGGYYTPKGTQPNFRLSESNIGYDARLF
SESWIVSPADSLWYPWSASVEVGKEGCKPWNKLYPRIIPMWKDYGQKEYTLREWRRGQEK
DTLICHLPYNMQLTPCLEVEAQGGDTISVCTDNYKGGGMYNLRAEYVTRKGRQSYESLGW
INGHAVYYILPKEITLINATYRETSYNTSFAGSFSCNDDFYNRLWTKAQRTLLVTMRDTY
MDCPDRERAQWWGDEVIESGESFYALCPQSHLLMKKGMYELMQWQKEDGTIFSPIPSSNY
QTELPGQMLASVGLYGFWNYYLNTGDTATIADLYDSVKRYLAVWEYNEDGTVKFRSGDWT
WGDWGTNVDIKGLFNAWYYLALDGVSRMAGVLGKEDDAADMKKEMSALKDAFNRAYWKGY
AYRADESLPHPDDRLQALAVLSGLADESKYEAILKLFRHYEYASPYMEKYVLEAMFRMNR
PCEALERMKKRFGKMVDYPRLTTLFEGWGIGPEGFGGGTYNHAWSGGGLTLLSQKVCGIA
PVKPGFKEFSLRPQMGFLTHAEMSMLSVNGRISVSLNRSEKELKIRLSVPSGAQALLPVG
EEVQQVKLEGKKIFKNKKFYPDKRYKADFSDGQAVRISGGEWEIELSYR

Enzyme Prediction     

No EC number prediction in MGYG000001512_00861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	310	716	5.1e-91	0.8194444444444444
CBM67	25	210	1.4e-29	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.99e-28	331	647	3	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.09e-11	658	723	1	69	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.12e-07	55	195	4	149	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
COG3408	GDB1	5.10e-05	439	578	350	507	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	0.004	438	547	109	221	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61942.1	0.0	1	769	1	769
QUT48047.1	7.37e-272	24	732	24	738
QQT79846.1	4.83e-270	1	731	1	729
QRP59702.1	4.83e-270	1	731	1	729
ASM67368.1	5.00e-270	1	731	2	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.23e-21	43	738	179	918	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3CIH_A	1.29e-15	330	712	300	690	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.23e-15	43	769	187	952	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	4.73e-07	331	766	730	1169	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999128	0.000164	0.000160	0.000147	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_00861.