CAZyme Information: MGYG000001512_01123

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01123
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		42675.09	8.3568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 171056; End: 172156 Strand: -

Full Sequence      

MKKSILFYLVLLFSFSVYARKEKKDVFASEYIRDIMLKTVRWQFSNPYHGARDWTNAAFY
AGAFAAWEVTGENEIYDKLMSIGQNLRWRPARRWYHADDIAVCQNYIDLYRTVGKREMIQ
PTIDTLALFISRPYPSKKKAVEIIKLWWCDALFMAPPVFVKLGITLNNPIYLEFSDIYFK
EAYDLLYDNNEKLFFRDLNYVIRNDRRNLLEANGKPIYWSRGNGWVMGGLVRILQELPAD
YKMRSFYESLFKEMASRVIELQQKDGLWRASLLDPDSYPGGEVSGSGFFCYALAWGINNG
LLDEELYRPFVEKTWKALNQCVSPEGRVGWVQPIGADPRKNFSEDSWEVYGTGAFLLAGS
EIIKMK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	363	2.3e-80	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.09e-73	35	366	10	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.14e-52	67	361	49	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62573.1	3.51e-275	1	366	1	366
SCD19936.1	4.66e-183	3	366	2	364
BBK86202.1	2.88e-182	23	366	24	366
SCM56593.1	6.68e-174	1	365	1	364
QIP17775.1	6.36e-156	23	366	7	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.28e-105	22	366	19	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	5.28e-65	24	364	25	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.63e-52	19	364	3	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	1.61e-11	59	362	46	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.64e-11	59	362	36	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	5.50e-105	1	366	1	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	8.12e-102	36	366	38	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	3.09e-65	51	363	89	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	8.84e-11	59	362	46	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000709	0.998091	0.000333	0.000281	0.000284	0.000244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_01123.