CAZyme Information: MGYG000001512_01487

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01487
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385	MGYG000001512_18|CGC6	44691.17	5.3257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 627052; End: 628209 Strand: -

Full Sequence      

MKKENQKWMKWPLGIILCIFAFSSCAENKYDLEHFPKDADPIIVGTRLVNRFLEQPHSQY
GNPLRINEPRVNITYPDVCAWVGGLWFAKSVDNKELTNRLEERFLPLLAEESRLQPVPNH
VDNNVFGTLPLELYMQTGKEEYKNLGMMYADTQWQLPEEGYTPEQKKWSEHGYSWQTRIW
IDDMFMITAVQGAAYRVTKDTTYATRAAREMVFYLDSIQQGNGLFYHSPEAPFCWGRGNG
WMAVGMAELLRILPEDNTYRPEIMRRYLKMMNKLKECQQENGMWLQLVDDPSMWEETSGS
AMFTYAMIVGVKKGWLGKEYAEAARKAWLSLVKYIDENGDMTNVCEGTNVGFTQKYYRDR
VPLTGDIHGIAPMIWCAYALTCNDL

Enzyme Prediction     

No EC number prediction in MGYG000001512_01487.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	71	379	2.1e-70	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.72e-49	81	378	29	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.87e-43	75	374	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63039.1	3.39e-303	1	385	1	385
ALJ58829.1	1.19e-182	17	380	10	396
QUT90057.1	1.19e-182	17	380	10	396
QUT79249.1	5.44e-179	16	380	16	382
QGT72495.1	5.44e-179	16	380	16	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.85e-22	203	376	190	372	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.95e-21	203	376	191	373	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
1NC5_A	1.17e-20	127	374	93	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.92e-20	127	374	83	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.08e-19	180	328	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.43e-20	127	374	93	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	4.39e-16	235	339	232	338	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	5.04e-14	228	379	57	226	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.04e-14	228	379	57	226	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	1.52e-12	81	339	98	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000166	0.063008	0.936750	0.000031	0.000055	0.000042

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_01487.