CAZyme Information: MGYG000001512_01781

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01781
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000001512_18|CGC12	53229.27	6.446

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 976040; End: 977434 Strand: +

Full Sequence      

MKKLLNIFFFYLLLLICLSCNASLKTETYLIEIPVPQRPAGQSDVIALTAPKIDTVRTGF
IGLGMRGPSAVSRFTHIPGVKIIALCDIRPECVEKTQKILDKNGYPRAISYTGSEDAWKQ
LCERDDIDLVYIATDWKHHADMAIYAMEHGKHVAVEVPAAMTLDEIWKLIDTSERTRKHC
MQLENCVYDYFELTTLNMAQQGLFGEILHVEGSYIHNLEEFWPEYWNNWRLDYNRRFRGD
IYATHGMGPACQLLNIHRGDKMNFLVAMDTKAVTGPDIIKKQTGEDILDFQNGDHTTTMI
RTEKGKTLMIQHNVMNPRPYSRMYQLTGTNGFANKYPVEGYVLRPTPISEKITPNFENLT
AHGFVSDDIKKALMEKYKHPIIKELEETAKQVGGHGGMDYIMDYRLIYCLRNGLPLDMDV
YDLAEWCCLAELTRISIENNSAPVTIPDFTRGNWNKLNELRFAY

Enzyme Prediction     

No EC number prediction in MGYG000001512_01781.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	52	456	6.7e-168	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.02e-21	55	355	3	279	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.49e-12	56	181	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	8.17e-07	56	168	18	145	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	7.73e-05	119	230	57	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63291.1	0.0	1	464	1	464
QQT79919.1	7.30e-266	1	464	1	467
QRP59786.1	7.30e-266	1	464	1	467
ASM67837.1	7.30e-266	1	464	1	467
QUU07859.1	7.58e-266	1	464	2	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.51e-94	34	454	21	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.41e-69	56	454	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	1.73e-15	116	354	55	271	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3EC7_A	1.07e-10	55	214	23	176	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4H3V_A	6.74e-09	109	241	58	192	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5LGZ0	2.33e-264	1	464	1	462	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	2.33e-264	1	464	1	462	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q89ZX8	3.03e-263	18	464	15	465	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	9.57e-261	16	464	12	469	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q7MWF4	1.82e-255	16	463	13	465	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000716	0.367315	0.631438	0.000157	0.000182	0.000175

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_01781.