CAZyme Information: MGYG000001512_01805

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01805
• CAZy Family: GH164
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672		76757.02	8.1001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1016405; End: 1018423 Strand: +

Full Sequence      

MRLPLILLFLSFLKTESCYAEKRMRMQIPLIGAQVIIEKGQTPQEIETFFQRLHENRMNI
CRIRMFEAYMHKSDGSWDFSLFDTAFRSAEKYNIKIFATLFPATSFSDIGGFKFPQDEIH
FANVKEYIRHVVCHFKKFSSLYGWVLVNEPGVSGKIPPGTFTSNHFENWKLQHKQIHSSL
KYPVLDFSQEKFLLDYNTWYLKRLSEEVRKYDVTSEIHVNNHNIFRNVAEYDFPSWSKFL
TSLGGSAHASWHFSYFNRSQYAVAMSLNSEIIRSGAQHIPWIMTEMQGGNNTYSGDNAMC
PTPEEIQQWLWIVIGTEAKGAIFWSLNARASGLESGEWALLDFQNNPSKRLTAAESVAKT
IQQNEKLFCNASVAESGISILYTRESMWIEKKMILQNNQLSGRQCGGVMKSAIGYFEALS
EMGIQCNFKSIDEFDFSKDNYLGKTLILANQISIPQKYWKPLENFVLKGGTLWIDGLSGY
YDENAICTFMTDSTPTDLFGGNLKEYILVDNIFDLNLSAIGINLPAHAWKGIIDNIDKKS
TQILGTDDEEITAITHYSGKGKTIWIPSLLGLGGRIEGYKPLQSLLNNILRDNLKNSPIR
FSKTVPETLMKVMKNGDNFISIIINKNKNKQNIELTLDKTLKPHILFANKNGNIIKNKVS
ISPEESIVILWK

Enzyme Prediction     

No EC number prediction in MGYG000001512_01805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH164	6	672	2.1e-280	0.9880597014925373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08532	Glyco_hydro_42M	8.57e-06	371	571	1	189	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	0.001	414	509	30	115	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE16426.1	1.58e-245	28	672	4	647
AMR30927.1	3.52e-243	19	671	3	651
QXV66431.1	1.61e-231	30	671	13	651
QHS54793.1	9.80e-228	30	671	13	651
EIY59668.1	2.09e-219	6	672	7	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T5O_AAA	7.29e-219	20	672	22	672	ChainAAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T5O_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T6G_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T75_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],6T7G_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],6T7G_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae CL02T12C01],7OMI_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMI_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_AAA Chain AAA, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_BBB Chain BBB, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_CCC Chain CCC, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_DDD Chain DDD, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_EEE Chain EEE, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae],7OMS_FFF Chain FFF, Glyco_hydro_42M domain-containing protein [Bacteroides salyersiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999158	0.000175	0.000142	0.000134	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_01805.