CAZyme Information: MGYG000001512_01834

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01834
• CAZy Family: PL35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	MGYG000001512_18|CGC14	69468.52	8.0153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1072658; End: 1074499 Strand: -

Full Sequence      

MIRYPKFFIVVFLSFVSMQLGFSQRTIDWSKLEKHPRLLLKEGEEMKIKEKLEQSPELQI
IHRNILNTADEFIFKPTNYYYKQGKRLLHVSRDAFRVLFNLSYAYRMTGDKRYAVRAEQE
LRAVAAFPNWNPSHFLDVGEMAMGVSIAYDWLYDDLSDKTKKMVEDAIEKFAFLPADPVY
TPDMGKDVNNWFYGATHNWNQVCNGGLGMAALALYESYPEKCDKILKRALETLPIALCEY
APDGAYPEGFGYWGYGTGFQAMLNTSLETALGTDFGLSDYPGFLRSGNYIQHMVAPSLQA
FGYSDSGANKVLSMSPMFYIAAKIGDTSLLYNELNLIRMNRFTETLLPSYLIYAKDLDFS
RVTAPTTKMWYGRGKTPVVLVRTDWVMGAKFLGLKGGCAQTSHAHLDAGSFVYESDGVRW
AIDLPQDSYLRIETAGIDLWNQNDGSERWNLLRQNNKYHNTLTVNDKNHLATAEIGIDKV
IDTPKKQGGVLDLTPLFRGDLSKAVREISLNNGDFLQIKDDIQASDSVTKVQWTMVTKAT
PKIVAPRKIELTQNNKKAELIIDSPKDVSWEVWNNNPGNTIETPNPGTCRVGFVKMLSPK
QKVSLKVRLVTKD

Enzyme Prediction     

No EC number prediction in MGYG000001512_01834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL35	389	566	4.7e-55	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	1.03e-05	385	469	17	90	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
cd04434	LanC_like	1.38e-04	97	260	7	152	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
pfam16332	DUF4962	5.02e-04	35	220	137	331	Domain of unknown function (DUF4962). This family consists of uncharacterized proteins around 870 residues in length and is mainly found in various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49750.1	9.90e-178	25	610	23	605
AYB29714.1	5.08e-176	15	610	8	599
QNL40059.1	7.68e-176	6	610	2	601
QGT72630.1	1.24e-174	6	610	2	601
QUR45369.1	7.02e-174	6	610	2	601

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000215	0.999213	0.000158	0.000137	0.000135	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_01834.