CAZyme Information: MGYG000001512_01886

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_01886
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000001512_18|CGC16	39186.9	6.8382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1152188; End: 1153195 Strand: -

Full Sequence      

MKNRLFIGSVIFLLLAVLPVAAKSKEEKGLAALSVKENVFVDESGRVVRLAGVSFSDPDK
LEKEGHWNFKYFKEAKKWGCNVVRFPVHPYTWRYRGAEAYMQLLDKGVKWAEKAGLYVII
DWHSIGNLPGDKYPHFNYATNWDETVKFWKLMAERYRNNSVVACYELFNEPIEEEHSLNW
EIWRPMMEKLIDEIRKIDNRKICLVAGMNWAYLLDEVIENPVNRSNVAYVTHPYPQKREQ
PWEDKWDADWGKVTKYYPVIATELGFVGAGERGEHIPVIGDETYGKAIIDYFDKKGVSYT
IWCFDPDWAPTLIEDYEFTPSRQGVFFKKVLQKNK

Enzyme Prediction     

No EC number prediction in MGYG000001512_01886.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	40	315	9.3e-120	0.996415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.73e-38	41	307	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.42e-14	64	194	67	215	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63367.1	5.44e-261	1	335	1	335
AXP79804.1	1.10e-128	27	332	23	331
QJW90914.1	4.84e-125	24	332	19	330
QMU30925.1	2.24e-124	1	333	1	336
AKD02203.1	2.97e-124	9	335	9	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	3.76e-106	18	335	37	359	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
5A8N_A	5.50e-102	25	331	43	359	Crystalstructure of the native form of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
5A8O_A	1.56e-101	25	331	43	359	Crystalstructure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with cellotetraose [Saccharophagus degradans 2-40],5A8P_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide B [Saccharophagus degradans 2-40],5A8Q_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A obtained by soaking [Saccharophagus degradans 2-40],5A94_A Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_B Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_C Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_D Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_E Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_F Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A95_A Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_B Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_C Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40]
5A8M_A	1.56e-101	25	330	43	358	Crystalstructure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_B Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_C Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
5WH8_A	3.80e-23	33	304	14	273	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	7.50e-17	33	302	116	369	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23548	1.43e-14	2	316	8	367	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
Q07940	4.85e-14	76	303	46	257	Endoglucanase 4 OS=Ruminococcus albus OX=1264 GN=Eg IV PE=1 SV=1
P27035	1.88e-13	75	304	200	413	Endoglucanase CelA OS=Streptomyces lividans OX=1916 GN=celA PE=1 SV=2
P06565	2.18e-13	26	302	33	288	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004212	0.963531	0.031426	0.000314	0.000262	0.000244

TMHMM  Annotations     

start	end
5	22