CAZyme Information: MGYG000001512_02313

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_02313
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		48488.4	6.6333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 352468; End: 353766 Strand: -

Full Sequence      

MKSMNNYKRKWNFKSILTILVVSGTIGTLNAQQDRRTEYPDFSYGEGVENNEWIQAIKVI
EPACRSHVKGKVNISFQAKGMKTAKAMCWSQPTDDNPNTWGHDVDLTPKGIHLKKDGTGK
FSFNADQFPNGPMNVRIYAQNDVNKDIFELQLYNDGGIKWNQGIPAQDPGIVKEKGLSLV
FSDDFDGPLSISNDGRGARYNAHKPCSGDFSGWPFSDVDHPLKPFRQIDTYLHIAARKEP
GTNGATGLIASVNMDGEGFWVKAPCYMECRFTAQSAPGTWPAFWTINQIHNAPGDELDII
EAYGGQGKGNPNYWGYSVTSHFWGQHNADGTPKDAVWKSIDMLKLGGKSSWSTTFHTYGM
YVGMDETIYYFDNMEVFRHPTNEISRDFPHLFMVNYAIGGISGWPIDLERYGNGSDMFVD
FVRVYAKPEKGK

Enzyme Prediction     

No EC number prediction in MGYG000001512_02313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	183	425	4e-42	0.995575221238938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	6.52e-22	181	425	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.07e-13	264	425	67	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	4.01e-06	176	425	1	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd02178	GH16_beta_agarase	1.71e-05	229	425	64	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	6.42e-04	266	405	35	151	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63801.1	0.0	1	432	1	432
QNL39435.1	3.25e-230	16	432	15	428
QGT72065.1	4.88e-230	16	432	7	420
BCI63372.1	2.10e-196	15	427	15	429
QJE96257.1	9.18e-185	14	429	2	418

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33680	1.81e-11	266	426	320	458	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q9Z3Q2	3.21e-11	177	426	218	458	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.998967	0.000204	0.000196	0.000148	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_02313.