CAZyme Information: MGYG000001512_02707

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_02707
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1051	MGYG000001512_19|CGC16	118284.15	4.7211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 853484; End: 856639 Strand: +

Full Sequence      

MKIKNLLFSMALICSLPIQAQDQLIDDFENGKLNFSSNGGEMGNFQYEVVTNPSKSGINT
SEYVLKFKRTVANTPNWGGYWFDLKEEIQSLVKPQEYRYAHVKYYRIDEQSYMKVKIEQS
TAGGAAKEMASINAPQKLNKWEDLVFDFEGAVGPYSRMTLMPDFVSDRPAGIEVYIDDIR
FNNDPNPLSIFTEMIPQDVTFSELTAISVKLEWVNIGEAVSYTVYNNGVEMKTVTTPFVT
LTELTPATEYKITIKANNADCEQSDASAEVIFTTLKAGELAMVTGLVNMDKIKEPTTDSS
HPQGWIYRENKYEDKINLEWNAVYNATRYEIYKNGVKVDETTDTKYTINGLQPHTIYYFQ
VKAVNEEGDSSELTPKLYAQTKETDEQRNERMAWWRDARFGMMITWGVHSAYAGEYNGKR
ADKHNGEGNYSEWIMFGQNIPVEEYKLKAADFTCENYDPEAWMQAAADAGMKYLVFISKH
HDGFALWDSKASDWNALKSSGAQRDVMRPLIEAARKRGIKIGIYYSHSLDWGNKGGLGWM
PQINKAPYFGKWDAESQEKYVNEVCIPQIKELLTEYGQVDVFWWDMGVSDLSLEYEQKML
GAIYESGQGDHIILNNRLRFDGSTPGDHETPEQSIPGVPATGYADGHDWETCMTMNDNWG
YSKHDTEWKTPADVIRKLIDIVSKGGNFLLNVGPKADGTFPEQSSYILSELHNYMQVNAE
AIHGTRACPLENGVPFGRVTSKVEGDRTTLYLHVFDWPADGKLLVPGLYNANAEISLLKD
GSSLHYTVEEQGLTIQVPAEAPTTYSSTIKVVVNEPLDMHVAPVVQDEDGTLTLTAETAI
LQDETGICRETLSDGKVSLGCWKGVPSTQELVQWYTKITKTGSFKVKGEIAAFDSGNFTL
SNDNSQSRISFVGTGGWNPENFKLIEMGTFDISQAGLQNINLTTVADGWHPLGLRKLVLE
PATMTSLDENQDIPIRIFVKDNKIYCELQVKQDCNVNFFLYNMQGELLYQDRNNYLNAGF
HTLSFVPRHSGLLLGKVIVGNKVVAQKVSIK

Enzyme Prediction     

No EC number prediction in MGYG000001512_02707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	370	724	1.2e-95	0.9421965317919075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	2.04e-103	392	768	20	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	9.70e-92	387	720	14	333	Alpha-L-fucosidase.
COG3669	AfuC	3.19e-44	432	768	38	352	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
cd00063	FN3	1.84e-08	313	375	14	88	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
cd00063	FN3	4.55e-08	196	274	4	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64379.1	0.0	1	1051	1	1051
BCI64378.1	1.57e-198	24	811	23	802
QMI79652.1	3.94e-133	314	811	40	573
QPH58506.1	3.00e-132	314	811	40	573
AXY73948.1	5.04e-126	391	960	37	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	2.93e-65	388	815	27	445	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
7DB5_A	1.02e-57	368	794	11	434	ChainA, Alpha-L-fucosidase [Vibrio sp. EJY3]
6O18_A	1.09e-51	389	701	2	325	ChainA, AlfC [Lacticaseibacillus casei],6O18_B Chain B, AlfC [Lacticaseibacillus casei],6O18_C Chain C, AlfC [Lacticaseibacillus casei],6O18_D Chain D, AlfC [Lacticaseibacillus casei],6O1A_A Chain A, AlfC [Lacticaseibacillus casei],6O1A_B Chain B, AlfC [Lacticaseibacillus casei],6O1A_C Chain C, AlfC [Lacticaseibacillus casei],6O1A_D Chain D, AlfC [Lacticaseibacillus casei]
6O1J_A	2.75e-51	389	701	2	325	ChainA, AlfC [Lacticaseibacillus casei],6O1J_B Chain B, AlfC [Lacticaseibacillus casei],6O1J_C Chain C, AlfC [Lacticaseibacillus casei],6O1J_D Chain D, AlfC [Lacticaseibacillus casei],6O1J_E Chain E, AlfC [Lacticaseibacillus casei],6O1J_F Chain F, AlfC [Lacticaseibacillus casei],6O1J_G Chain G, AlfC [Lacticaseibacillus casei],6O1J_H Chain H, AlfC [Lacticaseibacillus casei]
6O1I_A	6.94e-51	389	701	2	325	ChainA, AlfC [Lacticaseibacillus casei],6O1I_B Chain B, AlfC [Lacticaseibacillus casei],6O1I_C Chain C, AlfC [Lacticaseibacillus casei],6O1I_D Chain D, AlfC [Lacticaseibacillus casei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10901	2.05e-40	394	805	36	448	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q99KR8	3.64e-37	393	798	42	440	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
Q6AYS4	1.26e-35	393	798	40	438	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q9BTY2	4.75e-35	393	798	48	446	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q5RFI5	6.19e-35	393	798	46	444	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000796	0.888608	0.109747	0.000290	0.000274	0.000247

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_02707.