CAZyme Information: MGYG000001512_03060

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_03060
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000001512_19|CGC27	42931.49	5.7074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1316403; End: 1317512 Strand: +

Full Sequence      

MKNICLIGMIMLVCFSCKTTRKERMPVDSQATQETVALYNRLFDLMEKGIMLGHQDDPLY
GHGWYGEDGRSDVKSMTGDYPAMFGFELGHIELGAEYSLDSVYFSQIKKYVREHHARGGI
SSFSWHADNIATGNSTWDCAQDTVVRSILPGGSLHSNYLVWLDRLGDFFLDLKDDKGVYI
PVIFRMYHEHTGDWFWWSSKQSTPDEYKQLWVMTSDYLRNKKGVHNLLYAYSSSNVQSKE
HYLERYPGDEYVDILGFDHYLKGRSEENVDQYKIDFERNIQIVTDYAVQSGKLPVVGETG
EESIWDTSYFTSIVYPIISKYKLGWILFWRNAWELDKPNHYYLPFPGHPSEADFKKFVEK
PLILMNSNI

Enzyme Prediction     

No EC number prediction in MGYG000001512_03060.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	27	272	1.8e-61	0.768976897689769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.17e-42	27	294	1	264	Glycosyl hydrolase family 26.
COG4124	ManB2	4.49e-15	157	260	159	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64729.1	7.68e-276	1	369	1	369
QUT74990.1	2.19e-237	1	369	1	369
QIK53347.1	1.03e-182	15	369	16	372
AIA99594.1	4.76e-182	20	369	17	366
QIK58764.1	1.96e-180	15	369	16	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.30e-103	30	364	7	334	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	5.03e-74	27	369	34	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	5.03e-74	27	369	34	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	9.48e-74	27	369	57	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.96e-73	27	369	34	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	9.31e-60	27	344	50	381	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.58e-40	28	367	44	396	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	2.13e-17	28	305	148	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	2.39e-17	37	294	185	429	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
O05512	8.27e-16	26	334	31	329	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000012	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_03060.