CAZyme Information: MGYG000001512_03212

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_03212
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
921	MGYG000001512_19|CGC34	105467.46	5.1651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1542907; End: 1545672 Strand: +

Full Sequence      

MQASRSFKVFGCAVVLMMSHLQVQSINPVKDKMYPAFELDEVSLLDSEFKLRQDHDLKYL
ETLDPDMYLAHFRRNAGITTNSKGEAINNKNHYHGWEYGGSSTFGHYLSAISMMYKVTGD
VALLEKINYIIDELDYIQHNPVYSDESLNKGVLVAFDRDDQDKVKEPNFLRTFDELRNGI
VNLTTRSDDRNATATNPYYKTFYWLSGGLSWYTNHKIYAGIRDAYRYTGNEKAKDVFLYF
CDWACWVTENLTDEQFGKMLYSEHGGMNEMLTEAYAMTGDTKYLTYAKKFNESETISPCI
DGNMTRIATAISNTHANAQIPQFYGTLKEYEYTGETDFLNASKNFFKYVTEQQSFATGGN
SEWEQFRTANSINAQITRRSGESCNTYNMLKIAKGLFEYTGDEIYADYCERALYNHILAS
INTNELGAFTYFLSLEPGYFKTFSRPYDAHWCCVGTGMENHAKYGEFIYFHTDKDIYVNL
YVASELNWKDKSFKMTTETKFPYSENITYQIKESDGTSRAIYLRYPDWAEKGMTVTVNGQ
PIETSNVQRGSYIKIERNWAVNDKIEIVLPLTLWKEAVPGYSKRFAIFYGPVLLAGKLGT
ANMPESVLAGGENDYTKTTTYDYKGTLPVFTSNLAADKCLELTDASTLTFKSLATAPQNG
IEFVPLYNIMNERYSVYWTVSTDMGIAPESGKKYRIRWAGSSDDSPLYMTLKRTDNEKKY
ISAEELTSADSKDVQVWQIEYLDDSGVFKIVNPQQTDSCMSVYVYRGAAVARDSSVIYTK
FKATDYLYRWSLIQNNEGFALLNYKYPEFAMDLFNYDQRIHTYESNKGDNQRFIFEEVTD
ETGIYSVRDDKSVNVVGKNGILYVSSMSGIRHIELFLLSGQKVQDISGNDQTSLQIPVSG
QFYIVRIMTEQGIAVKKCLLR

Enzyme Prediction     

No EC number prediction in MGYG000001512_03212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	41	595	3.8e-162	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.96e-136	41	595	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.52e-92	49	605	23	511	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam18962	Por_Secre_tail	0.001	859	917	7	69	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQG80975.1	4.09e-126	11	678	5	628
QIX60435.1	4.91e-125	26	678	39	629
AND18711.1	5.75e-125	22	678	27	640
QUT86298.1	5.75e-125	22	678	27	640
AMP99677.1	5.88e-125	27	678	38	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.85e-108	37	683	28	653	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.30e-103	37	683	28	653	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
7EXU_A	1.84e-06	334	593	289	564	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	4.16e-06	334	593	289	564	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.19e-06	334	593	289	564	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999128	0.000190	0.000155	0.000143	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_03212.