CAZyme Information: MGYG000001512_03214

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_03214
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000001512_19|CGC34	77976.74	5.6967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1548854; End: 1550923 Strand: +

Full Sequence      

MFEKLKYLAGTIMGTFFCVSFMSSCSNQSSHVVAEVVERPNVSAVNVSYAGNKAPLQPQN
FMKLPVGQVQPTGWLKKYLLLQRDGLTGKLGEISAWLEKDNNAWLMSGGDHGWEEVPYWL
KGYGDLAYILGDTAMISEAKVWIEGAIRSQQPNGYFGPVNEKDGKKELWANMIMLWCLQS
YYEYSQDSRVIDLMTNYFKWQMTVPDEQFLKDYWENSRGGDNLLSVYWLYNKTGDKFLLD
LAKKIHRNTADWTNDSSLPNWHNVNIAQCFREPATYYMLSGDSADLAATYNVHNLVRRIF
GQVPGGMFGADENARMGYIDPRQGTETCGFVEQMASDELLLCMTGDPMWAEHCEEVAFNS
YPAAVMPDFKALRYITCPNQVVSDSKDHKPGIDNGGPFLAMNPFSSRCCQHNHAQGWPYY
IEHLVLATPDNGVATAIYGPCYATIKVGEKGVPVKITEETIYPFEETIRLKMEMPESVKF
PLYLRIPSWCENAEVKVNGRNAGVKAKRGKYVRLSGKWNNGDEVTLHFPMKIETVSWPTN
KESVSVNYGPLTFSLLIKEDYKKVKSNENAIWDSKWQKDADVDAWPTYEIYPGSPWNYAL
CASSDDLRQMVVEKREWPSDDFPFSANSVPIIIKAKGCRVPSWKIDKYGLCGVLPDENCK
QSDSIEDITLVPMGAARLRISAFPVAHQK

Enzyme Prediction     

No EC number prediction in MGYG000001512_03214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	188	552	4.5e-31	0.6998011928429424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.39e-132	100	554	49	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.71e-27	59	551	7	498	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO72059.1	1.17e-171	34	684	18	650
BCJ53767.1	4.04e-171	33	684	15	646
AEV84456.1	1.69e-170	49	684	32	647
SLM00256.1	1.69e-170	49	684	32	647
ATO82848.1	1.69e-170	49	684	32	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.54e-18	115	555	78	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.32e-16	115	555	78	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	1.35e-14	323	554	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	2.11e-14	326	555	381	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
5OPJ_A	1.22e-13	323	554	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000006	0.001514	0.998508	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_03214.