CAZyme Information: MGYG000001512_03307

Basic Information

• Species: Coprobacter secundus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter secundus
• CAZyme ID: MGYG000001512_03307
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000001512_19|CGC37	44203.4	5.1694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001512	4253015	Isolate	not provided	not provided

• Gene Location: Start: 1685439; End: 1686587 Strand: +

Full Sequence      

MGRFGILFLVVWCCVWCSPAGARVYSDQLDKADVRRVVTDVAAWQIEAYPRMDEKRYWKS
NGDLSWENGVFLSALASWAEFDGNGEFIEWYESVCERNRYQLSGGANRIYFADDLAVALM
YARLYMKRQEDCIIHPTVSRLEFIMNHPSPSGFYIDTPHAKDRWSWCDALYMAPPVFAAF
ANITCNPRLREFMDREYWMSYRFLFDKREKLFYRDSSYFGKRERNGEKVFWGRGNAWVVA
GLSLLIPQLPDDFVSRGRYIELFKEMMSRIVTFQDGKGYWHASLLDPASYPSPETSSTGF
FTFALWWGINAGLLDEDIYLPYARRGWEALVASVQPDGMLGWVQPVGADPQRVTKEMTEV
YGAGAFMLAGKEIMVYLDSVKE

Enzyme Prediction     

No EC number prediction in MGYG000001512_03307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	374	2e-76	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.63e-74	37	372	1	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.69e-52	51	372	21	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61707.1	3.00e-300	1	382	1	382
SCD21019.1	4.73e-120	4	381	2	399
QDO67620.1	3.26e-111	1	373	1	367
ASM65072.1	1.85e-110	31	373	28	367
QUU06865.1	1.85e-110	31	373	28	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.09e-69	66	374	53	367	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.04e-53	9	380	12	378	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.28e-45	66	378	39	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.68e-73	31	376	54	411	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	7.24e-69	66	374	60	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	4.88e-66	7	374	6	373	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000214	0.999220	0.000160	0.000140	0.000126	0.000121

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001512_03307.