CAZyme Information: MGYG000001513_00582

Basic Information

• Species: Clostridium_P massiliamazoniense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P massiliamazoniense
• CAZyme ID: MGYG000001513_00582
• CAZy Family: GH31
• CAZyme Description: Oligosaccharide 4-alpha-D-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745		87523.76	4.9344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001513	3732600	Isolate	not provided	not provided

• Gene Location: Start: 373845; End: 376082 Strand: +

Full Sequence      

MMDLKYREDLNQKFKLYRDSNRIYGSYEVNNNEIIVDFQGIKIKITYFNDEVVKVFFFEE
GEIESITNAVILKAVSKELKVKENKDFLFINGEKVVTVVDKRTTEITFKDTDGNIICEDF
QPTFKDDEGNIYISKVNSAKAYYGLGEKGGSLNKKGTYTENYNTDDPDTDDSYLKYYKTI
PFYVALQENKPYGIFFDNSYRSYFDMGKAYEDRIFFGAVGGQALYYFILGDSIKDIVSNY
GDLTGKMDVPPIWSLGYQQNRFSYFTQEEVKDIVETFEKKEIPLDVVYLDIDYMDGFRVM
TFKEPHFNKAKELISELEEKGIKVVTIVDPGVKVDEDYGIYKRGLKENHFTKKLDGDVFV
GAVWPGDSAFPDFSNSDARNWWKDELKKFIKNYNISGIWNDMNEPCVFNSDSKTMDERCI
HNGDFGVIEHKEFHNRYGLEMSRCSHEAQRELHENKREFSMTRATYAGGQRYSSIWTGDN
SSKWDQMRMSISMNANLGISGFSFVGNDVGGFGLDCTEELFIRWMELGVFLPIFRNHSNM
YTRRQEPWAFGTRAEKIAKKHIELRYELMPYIYNCFYQSYKEGIPVFRPLVMEFENDENV
YNMREQFMFGHSILVAPVFYEGEREKIVYLPEGNWYNYKTNECFKGKKRYKFKCPLDEIL
FFIKEGSIIPTYNEKYKNMEERPNKVLHKIYGENAKSTYYYDDGKSMEYKNNKFNLYNIV
VQDGEISVETVEKNIEEENFSFILI

Enzyme Prediction     

No EC number prediction in MGYG000001513_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	225	669	8.2e-166	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	0.0	33	738	55	741	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06604	GH31_glucosidase_II_MalA	0.0	245	583	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
pfam01055	Glyco_hydro_31	0.0	226	669	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	6.53e-170	250	706	6	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PLN02763	PLN02763	1.71e-136	119	714	52	643	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQM60579.1	0.0	1	738	1	738
AIY83198.1	0.0	1	738	1	738
QBJ74486.1	0.0	1	743	1	744
ATD54201.1	0.0	1	743	1	744
SLK12847.1	0.0	1	743	1	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JR6_A	3.20e-109	26	714	35	737	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	4.68e-108	26	714	35	737	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5DJW_A	1.34e-106	136	745	58	663	Crystalstructure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2G3M_A	2.81e-103	144	675	66	614	Crystalstructure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3M_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA [Saccharolobus solfataricus],2G3N_A Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_B Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_C Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_D Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_E Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus],2G3N_F Crystal structure of the Sulfolobus solfataricus alpha-glucosidase MalA in complex with beta-octyl-glucopyranoside [Saccharolobus solfataricus]
3NUK_A	1.76e-99	143	709	54	655	ChainA, ALPHA-GLUCOSIDASE [Blautia obeum ATCC 29174],3NUK_B Chain B, ALPHA-GLUCOSIDASE [Blautia obeum ATCC 29174],3PHA_A The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_B The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_C The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],3PHA_D The crystal structure of the W169Y mutant of alpha-glucosidase (gh31 family) from Ruminococcus obeum atcc 29174 in complex with acarbose [Blautia obeum ATCC 29174],6C9Z_A Chain A, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6C9Z_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA3_A Chain A, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174],6CA3_B Chain B, Glycosyl hydrolase, family 31 [Blautia obeum ATCC 29174]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	8.99e-183	43	734	47	741	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B9F676	5.51e-106	177	741	274	854	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P0CD66	1.54e-102	144	675	66	614	Alpha-glucosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=malA PE=1 SV=1
D0KQM8	1.83e-102	144	675	66	614	Alpha-glucosidase OS=Saccharolobus solfataricus (strain 98/2) OX=555311 GN=malA PE=1 SV=1
Q9FN05	2.37e-101	226	714	335	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001513_00582.