CAZyme Information: MGYG000001513_02012

Basic Information

• Species: Clostridium_P massiliamazoniense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P massiliamazoniense
• CAZyme ID: MGYG000001513_02012
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		41784.41	6.5113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001513	3732600	Isolate	not provided	not provided

• Gene Location: Start: 554760; End: 555830 Strand: -

Full Sequence      

MIKKIIAIASIIIIIVITFFLGFTYINKKNSSYGSINQYRDLKSGDLATDYTIPQALNDI
KSMNLNTINIPIVVNIKTLNSNEVEIENWSLDRAIELIKELKGTNVKIILEPYPWIDNGS
KYETNFNPTDKKLFFENWEDNVIKPILNKVAIPYNVFAINIASNFVNLYSYSTYWDNIIA
YIRKNFKGFITYKVSWWYTAKWDRNSYKNFDDVLNNETLSRVDFISVAAYFELSNNEYNT
VEQLKNDLYSTTRYNREQDVVKQLYELHKKWNKPIFFGELGFPKKAGAAIEPWNENISNT
VNDTEQANCFKAYEEVFSKKDWILGFSVFAIGNNNTDHWYYPCNESKEIIKNWYNK

Enzyme Prediction     

No EC number prediction in MGYG000001513_02012.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	53	335	1.6e-47	0.8594771241830066

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	1.32e-52	44	354	12	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	1.12e-16	92	341	63	291	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APC79513.1	7.17e-127	26	356	30	364
ACA45402.1	4.11e-126	26	356	30	364
AUN06467.1	1.66e-125	42	356	50	364
AXG95299.1	1.66e-125	42	356	50	364
APH21414.1	1.66e-125	42	356	50	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YLH_A	3.55e-14	78	329	49	273	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
4CD6_A	1.32e-06	175	329	162	281	Thestructure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG [Alicyclobacillus acidocaldarius],4CD7_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD7_B The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD8_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManMIm [Alicyclobacillus acidocaldarius]
3CIV_A	1.43e-06	175	329	185	304	Crystalstructure of the endo-beta-1,4-mannanase from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.853826	0.128144	0.014470	0.000732	0.000381	0.002469

TMHMM  Annotations     

start	end
5	27