CAZyme Information: MGYG000001513_02728

Basic Information

• Species: Clostridium_P massiliamazoniense
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P massiliamazoniense
• CAZyme ID: MGYG000001513_02728
• CAZy Family: CBM2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1054		117251.48	4.9792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001513	3732600	Isolate	not provided	not provided

• Gene Location: Start: 1314642; End: 1317806 Strand: +

Full Sequence      

MRKLKSKLTKTLSLLISFAFILALVPTSYATATEKNNVKAASGAPGKPLLQHDQYGNDCD
GNYNINFNMWHGNNGTSYKLYERIGIKNDFTVVAEGKLEDETPGPQTGTIQITGRTIPGT
YYYYLELSNSFGTTISETISLRVGSAETSKIVIDKIDDQRTEIQFTVPQGNSQYKLIHVD
AKEPKFKVISSNTSSVKASILNGDTLKIEAIGEGRSGLKIIEESTGEIRQIGCRVLKADG
KVPGMPNYLSIGQVSEDTDNDLNFWKETSNDDTNKRTDIRYIYINGGPISGWRKWTTEDG
ARAKKYITESLKLGMIPFFVYYNIPDDAEDYAVDIAHINDKAYMEAYFQDLKFLLDICKE
YAGDETVGMVFEPDFLGYMMQQSGKQPNEISAVVDAAYSSGILEKGKDPNFENNVKGLVE
AINYTVEKYYPQAYNGWQFNIWAFSEPGIPSQGVLHKTEFIGMEEGQKYIEDVARKTAEY
YLAAGINSYGTEFISIDKYGLDGAYEPGAAENPKDSKWLWNSDIWNNYLLYTKTLHKTTE
KPVILWQIPVGHLNSSQENNPYDSSGKFKDLTNAVGNYEDSAPTFFFGDTFEAGGGKRTE
YFGTNEYNDPKIKAQGDTITWGNHMKEAKDAGVVSILFGAGVGASTDAVGSPASDNYWWI
TKAQRYLKNPLPLDPSDIEQPENNLPRKPSISADNVENKGNYTLSVRIPEKSLATSYKLF
ENGKEIKSGAVSEKALDFEVPFTNKAVGKYNYYVELTNNHGKTSSDTITINVISETENPN
PNPDPKPEENNVDVNFEVTQDWGTSANYQITITNKTNKELQNWNLSFEFSKKISNAWDVQ
FSENNGLYCFKPNSWNGTIAPGKSISFGGACDGNVGSLKPTNIKFTADGLEDSTPETPKV
PEKPENNLPLKGTLTTSTTNSKDGNYSLTLTLPNNHNTTSYEVLENNKSIKSASFASSST
LIKEDFKNRTDGNYTYEVILKNKNGETKTSKVTVSVKKENAEKPTPGVNPWKANVNYKSG
DIVSYNNKEYKCTQPHLSLNGWEPTNVPALWSQK

Enzyme Prediction     

No EC number prediction in MGYG000001513_02728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM2	793	886	2.5e-21	0.9405940594059405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd12214	ChiA1_BD	4.03e-16	1010	1052	1	43	chitin-binding domain of Chi A1-like proteins. This group contains proteins related to the chitin binding domain of chitinase A1 (ChiA1) of Bacillus circulans WL-12. Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal and catalytic domain, and 2 fibronectin type III-like domains. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiAi chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)).
smart00637	CBD_II	1.02e-14	799	868	1	72	CBD_II domain.
pfam00553	CBM_2	5.30e-14	794	889	3	98	Cellulose binding domain. Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.
smart00495	ChtBD3	1.35e-05	1010	1051	3	41	Chitin-binding domain type 3.
cd00036	ChtBD3	2.41e-04	1011	1053	2	40	Chitin/cellulose binding domains of chitinase and related enzymes. This group contains proteins related to the cellulose-binding domain of Erwinia chrysanthemi endoglucanase Z (EGZ) and Serratia marcescens chitinase B (ChiB). Gram negative plant parasite Erwinia chrysanthemi produces a variety of depolymerizing enzymes to metabolize pectin and cellulose on the host plant. Cellulase EGZ has a modular structure, with an N-terminal catalytic domain linked to a C-terminal cellulose-binding domain (CBD). CBD mediates the secretion activity of EGZ. Chitinases allow certain bacteria to utilize chitin as a energy source. Typically, non-plant chitinases are of the glycosidase family 18. Bacillus circulans Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal catalytic domain, and 2 fibronectin type III-like domains. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiA1 chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)). Streptomyces griseus Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. ChiC contains the characteristic chitin-binding aromatic residues. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSW17965.1	0.0	7	885	6	967
QEG18288.1	1.85e-196	61	749	143	821
QGQ28725.1	4.06e-196	61	749	180	858
QDV49819.1	7.62e-196	61	769	182	896
QDT41727.1	3.75e-195	61	769	178	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ED7_A	5.74e-14	1011	1051	2	42	ChainA, CHITINASE A1 [Niallia circulans]
6BT9_A	8.78e-11	789	878	574	664	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
2RTT_A	3.71e-10	796	885	8	96	Solutionstructure of the chitin-binding domain of Chi18aC from Streptomyces coelicolor [Streptomyces coelicolor]
4ILV_A	4.68e-08	1006	1053	200	247	Structureof the dioxygenase domain of SACTE_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILV_B Structure of the dioxygenase domain of SACTE_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
3NDY_E	8.26e-06	792	891	3	103	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_F The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_G The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_H The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_E The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_F The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_G The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_H The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	3.72e-15	971	1051	617	696	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P27050	7.34e-11	1011	1051	34	74	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
P27033	3.09e-08	796	887	41	132	Endoglucanase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celC PE=1 SV=2
P36909	3.65e-08	796	901	38	148	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
P11220	6.26e-08	796	904	38	148	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000969	0.998027	0.000248	0.000284	0.000239	0.000219

TMHMM  Annotations     

start	end
12	31