CAZyme Information: MGYG000001514_01427

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01427
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000001514_11|CGC11	38939.95	5.2899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 438111; End: 439127 Strand: -

Full Sequence      

MTTRAIRTEAALKEMFAEDFQIGAAVNPMTIRTQEELLAYHFNSITAENEMKFASLQPEE
GAYAFDEADRLAAFARKHGMAMRGHTLVWHNQSTGWLFEDKQGNPVDKATLLERLKSHIH
TVVGRYKNDIYAWDVVNEVIEDEGDGLLRRSKWLDIAGPEFIARAFEYAHEADPNALLFY
NDYNESNPAKRDKIHALVKSLLEQGVPIHGIGLQAHWNLYGPSLGEIRAALEKYASLGLQ
LQLTELDMSLFRFDDKRTDITEPPAELLELQAERYEEIFKLLREYRDVITSVTFWGAADD
YTWLNDFPVRGRKNWPFLFDEQHHPKLAFHRVAALSRQ

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	12	333	3.7e-114	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.21e-131	51	332	1	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.70e-131	12	334	1	310	Glycosyl hydrolase family 10.
COG3693	XynA	1.10e-108	35	333	51	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACP87317.1	2.90e-253	1	338	1	338
ACW01945.1	2.90e-253	1	338	1	338
AZK45725.1	1.43e-208	4	336	16	348
AWV35730.1	2.65e-194	8	332	16	340
AYB47520.1	2.71e-194	7	332	6	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQW_A	9.47e-158	9	332	3	326	ChainA, Beta-xylanase [Thermobacillus composti]
1N82_A	3.45e-157	11	335	7	331	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	1.99e-156	11	335	7	331	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	2.82e-156	11	335	7	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	1.62e-155	11	335	7	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O69231	3.17e-148	11	332	7	328	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P45703	1.20e-147	11	332	7	327	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P23556	3.10e-119	11	332	16	339	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	8.68e-114	11	332	34	349	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	3.58e-96	11	336	44	373	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_01427.