CAZyme Information: MGYG000001514_01444

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01444
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000001514_11|CGC11	37348.23	5.1436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 467250; End: 468221 Strand: +

Full Sequence      

MHTMNTAPCNPKASPEVRAVLNYLSEIRGKGIITGQHTQTIAQDELHYIREVTGKLPALC
GFELLGYSPNINYKDSSEECLLEVTENKDTLQKAWEWAEKEKGLITFTWHWFSPLGGRDK
SFYTEHTDFDAAKAAVEGTAEHEALLSDMDDMAEILREFRDKRIPILWRPFHEAEGTWFW
WGSKGPVVAKELYRIMYDRYTKHHDLTNLIWVWNSPTPEGYVGDDVADIISRDLYPPAHQ
HTDLRQEYEELIRITPTPKLAALGEIGPIPCIQSLSESRIPWLWFMTWSNDFGKTEKFTT
KAELYSAYHSDYAITLDKLPKLY

Enzyme Prediction     

No EC number prediction in MGYG000001514_01444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	10	317	2.4e-95	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.34e-47	10	317	2	310	Glycosyl hydrolase family 26.
COG4124	ManB2	8.09e-13	164	255	180	279	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK45707.1	4.45e-224	4	323	2	321
AIQ66101.1	9.07e-179	8	323	10	325
AOZ93051.1	1.76e-178	5	323	6	324
CQR54080.1	7.57e-173	4	323	5	324
QUL56288.1	3.57e-171	4	323	5	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	4.10e-68	2	319	139	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	8.94e-68	5	307	3	301	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.54e-44	4	320	30	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.64e-42	9	288	46	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	2.19e-41	8	319	23	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	8.53e-73	2	319	168	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
A2R6F5	3.29e-54	3	317	23	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P49425	3.94e-53	12	320	150	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	4.29e-53	3	319	23	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55296	5.86e-45	4	320	153	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_01444.