CAZyme Information: MGYG000001514_01534

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01534
• CAZy Family: GT2
• CAZyme Description: Tyrocidine synthase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1565	MGYG000001514_11|CGC15	175945.41	5.0648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 590842; End: 595539 Strand: +

Full Sequence      

MKNLTDRIQSLTPEQRALFEKRLKEQNLNAQQLSPNPAAAAIPRRNHTGLSPLSFDQERL
WLFQRMHPESHAYNVYGAARLRGKLHHGALEYGINEIVKRHEAWRTVFGRVDPVQTVLPE
LRVSVPVVDLQDIPEEEREAVAQQLMREEVQQLFDLEKGPLIRFKLFTLSDMESMLVLTV
HHIVIDRLTFSIFFEELMAHYKAALAGVPAELPELPIQYADYAEWQRNYLQGETREKLLA
FWKEQLKDCEYILDIHTDFPRPPAITYRGARVFLRSSKETLDGLKAIAKRENASAFMIVM
AAFKALLYRYTGQADILVGTPLANRSRIEMEKVMGYFLTMGTLRSRVSGETIFIDLLRQV
RDTAREVYKHQELPIGLLLDELRIPIDPSRNPLVQAVFVYVDVPEEKFALPDLEADIEMI
DGETAKYDITIGLTETEDGLDGFLEYSPDLFRRETFERMSRHWEALLHSIVRDPQQSLHE
LAMLSDEERHQLIDEWNETVQPFPDDSCIHHLFERQAELTPDDPAVVCGGQSMTYRELNR
RANQVAHALQKRGVGKETAVGLMMERSFETVVGLLGILKAGGAYVAIDPAYPAERIRTMI
EDSGIEVLLIQPKLAHAEAESGSAVRHKLVLDGSAWQSISEENADNPRIKVDAGDLAYVM
YTSGSTGKPKSVAIEHRSVCNAVEAAIGLFGLSRGDRMLQYASPTFDASVLEIFATLASG
AALCIVSPEATAGGEALHRFLEEQRITAMVLTPSVLSTLTPEHLPDSLRTVGSGGEACTL
DIRAWLSDSRRLLNMYGPTEATIFATAHEFDTDSLTACIGLPIANTQIYILDECLQPVPV
GVRGEIYISGACLARGYRNNPELTAERFVDHPYRPGEVMYRTGDYGCRLPDGSIEYLGRR
DDQVKLNGVRIETGEIEAALNRHPAIKEAAVLVRQSASTSASGKALCAYYVADRDLDTAE
LRKLLFNQLPTYMIPAYYVRLDAFPLTSSGKLDRKRLPEPSAIGGLAADFVPPEGELEEL
MASVWQEVLGAETVGREDNFFHLGGDSIKAIQIASRLYRRGWDLEMNNIFLTPVLKELCL
DLKPADGQVQIPQDAVEGPIAETPIVQWFFDRDFASSAHWNSAVMLHSETALDETALKRA
LESLAEHHDVLRSVVRDEGDRKQLYNRGPAEQPMIGFEVVALDGGDSMESAVLAHANRLQ
ESIDLANGPLMKTALFRTPQGDHLLLVAHHLVMDWVSLGIMLEDLEAAYGQALNHGAIVM
PPKTHSFQAWAEALQQYARSGEVLREADYWAAVESTPCVPVPRDFEATGDWTKDEAQVMV
TLPPEETERLLKQVHRAYNTEINDILLTALGLTLKEWMNTNRIVIHLEGHGRQSTIKNMN
ITRTVGWFTSQFPIVLPIEHTEDLGYQIKSVKEHLRQLPNHGIGYGLLKYITPRESLPGM
LFTQQPDICFNYLGQINTDLRNRWFGPSPWPVGRTISPEAERKASLFIIGYVQDRRLHIV
MEYNRTHHRQDTIAALLDKLQNRLVDLIRHCGEQTAAEATPSDLGYNRLTLQELDQLNNL
VDMIE

Enzyme Prediction     

No EC number prediction in MGYG000001514_01534.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12316	PRK12316	0.0	98	1087	4149	5144	peptide synthase; Provisional
PRK12467	PRK12467	0.0	97	1078	2692	3668	peptide synthase; Provisional
PRK12467	PRK12467	0.0	4	1354	9	1373	peptide synthase; Provisional
PRK12467	PRK12467	0.0	16	1565	1082	2644	peptide synthase; Provisional
cd17651	A_NRPS_VisG_like	0.0	513	998	1	491	similar to adenylation domain of virginiamycin S synthetase. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes virginiamycin S synthetase (VisG) in Streptomyces virginiae; VisG is involved in virginiamycin S (VS) biosynthesis as the provider of an L-pheGly molecule, a highly specific substrate for the last condensation step by VisF. This family also includes linear gramicidin synthetase B (LgrB) in Brevibacillus brevis. Substrate specificity analysis using residues of the substrate-binding pockets of all 16 adenylation domains has shown good agreement of the substrate amino acids predicted with the sequence of linear gramicidin. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAY30132.1	1.48e-212	31	1083	2228	3295
BAZ00088.1	6.76e-212	34	1083	2228	3293
BAZ75991.1	6.76e-212	34	1083	2228	3293
BAY90071.1	2.91e-209	34	1057	2219	3257
QND46664.1	6.69e-198	41	1100	1605	2687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P1J_A	1.81e-196	52	997	7	964	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]
6OYF_A	6.15e-176	51	908	3	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module [Eleftheria terrae],6OZV_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with AMP [Eleftheria terrae],6P4U_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg and AMP [Eleftheria terrae]
6P3I_A	1.01e-170	51	908	3	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg [Eleftheria terrae]
6MFZ_A	1.20e-168	57	1078	792	1793	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
6MFX_A	2.48e-152	504	1534	202	1194	Crystalstructure of a 4-domain construct of a mutant of LgrA in the substrate donation state [Brevibacillus parabrevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27206	0.0	39	1557	2089	3583	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4
Q04747	0.0	52	1565	2098	3579	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3
O30408	0.0	34	1557	2081	3583	Tyrocidine synthase 2 OS=Brevibacillus parabrevis OX=54914 GN=tycB PE=1 SV=1
P39847	3.96e-319	52	1562	1059	2553	Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsC PE=1 SV=2
Q70LM5	1.70e-318	42	1556	3646	5175	Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis OX=54914 GN=lgrC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_01534.