CAZyme Information: MGYG000001514_01783

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01783
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		51661.13	5.367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 182078; End: 183559 Strand: -

Full Sequence      

MKKSLFGMLGKPGRVVPLLLVFVMLIGLLPLTAAAADRGAWAPNVSYAINDTATYGGKTY
RTVQSHTSLNGWEPPNVPALWELVKDGGGDGGEGSDTVAPTAPANLTASGVTSSSVTLTW
SASTDNVGVTGYEVYQGSSVVLSVTGTTATVTGLTAGTTYSFKVVAKDAAGNRSPDSAVI
SVTTTTGNDGGAGGQLPKHTLTGYWHNFINNSSNLKVRDVPSQYDIIVLSFAEMDPAKPG
GVTFSVDPSLSTALGGYSNADLIADIQSKRAQGKKVIISIGGEKGNINLNSASPNVTNFV
ESMYGIITQFGLDGVDIDLEHGMNVTNLTNAIRQLQQRVGSDFILTMAPQTIDMQNPNTS
YMQLYNNLKDITSVINVQYYNSGCMLGRDGKCYSQGTVDFLTALSDLSLQWVAPSQLGIG
VPATPSAAGGGYVSPTVVNNALNCLATGNGCGNYKPVAKYPDIRGAMTWSINWDATTNYS
LANTVKPFLNSLP

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	200	426	1.7e-26	0.6587837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02871	GH18_chitinase_D-like	2.52e-127	199	488	1	312	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
COG3469	Chi1	3.20e-40	201	492	28	325	Chitinase [Carbohydrate transport and metabolism].
cd02877	GH18_hevamine_XipI_class_III	4.34e-20	222	480	23	275	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
cd00598	GH18_chitinase-like	1.41e-19	203	381	3	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
pfam00704	Glyco_hydro_18	7.62e-19	203	474	4	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK44952.1	1.93e-306	1	493	1	490
SMF74509.1	4.01e-294	1	493	1	489
AWP27434.1	3.97e-282	1	493	1	487
AVV58271.1	4.62e-281	1	493	1	487
ACX65998.1	7.28e-271	1	493	1	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EBV_A	2.88e-105	198	492	4	294	Crystalstructure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
4TX8_A	3.27e-66	198	493	106	421	CrystalStructure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]
5KZ6_A	2.15e-56	192	493	3	333	1.25Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]
3N11_A	7.64e-56	196	492	4	329	Crystalstricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	2.10e-55	196	492	4	329	Crystalstricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27050	5.45e-118	15	492	10	514	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
Q05638	1.31e-59	59	484	129	591	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1
D4AVJ0	1.65e-53	219	493	19	332	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
A5FB63	8.56e-32	196	477	1139	1465	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
P20533	1.59e-23	96	185	461	550	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000504	0.998781	0.000211	0.000166	0.000148	0.000144

TMHMM  Annotations     

start	end
13	35