CAZyme Information: MGYG000001514_01919

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_01919
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001514_12|CGC5	44043.43	5.012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 354443; End: 355597 Strand: -

Full Sequence      

MDSALRPAHIFVEPSEQRFRDDYRRWQGIPSIEVTEKGRIFINFYSGQGAEVGGNIMVLC
VSDDHGQTFRSGVAVVEHPDPECRIYDPNLWIDPFKRLWMTWTQARGFNDGRMGVWVSIC
ENPDAETLSWTPPRRIANGIMMNKPIVTSKQEWLFPCAIWCNTCGSTPSEDHGLQHEQFS
NVYVSTDNGKTFELRGHADVPNRSFDEHMIVEKQDGALWMLVRTFDGVGESISEDGGYTW
SPGRKSHIDGPCSRFHIRRLKSGRLLMINHYDFNERIDLEDILNQGDVKKWKGRSHLTAL
LSEDDGKTWPYTLLLDERNEVSYPDAVEAEDGYIYVTYDWERVTQREILMARFTEEDIIQ
GKCSSPNAVLKKVVNKATGQPDVE

Enzyme Prediction     

No EC number prediction in MGYG000001514_01919.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	28	343	4.7e-27	0.9005847953216374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.23e-41	29	354	16	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	4.16e-21	129	336	93	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	5.42e-05	143	353	146	371	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	0.003	180	316	1	114	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV18850.1	2.06e-215	2	383	5	386
AEN08048.1	1.04e-170	5	384	7	383
AWL41261.1	2.35e-169	5	384	7	382
AHF93797.1	6.20e-115	2	376	9	371
QDT79764.1	5.30e-113	2	381	31	392

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_01919.