CAZyme Information: MGYG000001514_04297

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_04297
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		33041.62	4.5871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 3078619; End: 3079497 Strand: -

Full Sequence      

MSAQPILVSVIISVQNEGIDLQTTLESMKVSRVAARYEVIIVDEGSVDGCCDFLMNYKFE
MPLRKLKAQSGISSRQLGASQAVGEYLIFCSPRLYFEDGWMEALLEPIRQGRADCTTPSF
TAQGRPSNVQRYDLPSQGLFASIYNFPAVSEEGDIPWLSWDCFAVLRETFQEIGGLEGCF
YTKEIETAEFSLRTWLLGRVCYYVPDVCLTLVFRHNYPPDGRAAYWGSDAIALARLHFGR
EIVDKTREQVLACGGEPPSGLELEDAHEVREKRLGDYRYEPEWIARRFGILL

Enzyme Prediction     

No EC number prediction in MGYG000001514_04297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	9	219	1e-26	0.7796610169491526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	3.47e-13	9	167	1	160	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	4.07e-12	7	226	1	222	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd02510	pp-GalNAc-T	2.21e-09	9	198	1	211	pp-GalNAc-T initiates the formation of mucin-type O-linked glycans. UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins.
PRK10073	PRK10073	3.52e-09	1	117	2	119	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	5.03e-07	10	118	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK48091.1	6.50e-156	1	292	1	292
QNF28463.1	8.90e-42	1	290	1	290
AGK52774.1	9.35e-42	7	290	9	292
ASS96799.1	4.06e-40	7	290	9	293
SQI61474.1	2.06e-39	1	290	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S22_A	5.48e-07	9	218	186	420	Crystalstructure of the TgGalNAc-T3 in complex with UDP, manganese and FGF23c [Taeniopygia guttata],6S24_A Crystal structure of the TgGalNAc-T3 in complex with UDP, manganese and the peptide 3 [Taeniopygia guttata]
2D7I_A	9.34e-06	9	218	115	344	Crystalstructure of pp-GalNAc-T10 with UDP, GalNAc and Mn2+ [Homo sapiens],2D7R_A Crystal structure of pp-GalNAc-T10 complexed with GalNAc-Ser on lectin domain [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9VUT6	1.96e-15	8	214	130	353	Polypeptide N-acetylgalactosaminyltransferase 8 OS=Drosophila melanogaster OX=7227 GN=Pgant8 PE=1 SV=1
Q6DJR8	3.86e-08	7	272	145	425	Polypeptide N-acetylgalactosaminyltransferase 11 OS=Xenopus tropicalis OX=8364 GN=galnt11 PE=1 SV=2
Q7Z4T8	7.90e-08	38	205	168	354	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Homo sapiens OX=9606 GN=GALNTL5 PE=2 SV=3
Q8MVS5	2.99e-07	38	221	182	389	Polypeptide N-acetylgalactosaminyltransferase 35A OS=Drosophila melanogaster OX=7227 GN=Pgant35A PE=1 SV=2
Q95JX4	3.38e-07	38	205	168	354	Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 OS=Macaca fascicularis OX=9541 GN=GALNTL5 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_04297.