CAZyme Information: MGYG000001514_04793

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_04793
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000001514_12|CGC60	37584.11	5.224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 3581261; End: 3582271 Strand: -

Full Sequence      

MVELTGLSPVQISEHIIVGKESFCHFQSIQAAVDFLERYAADTVQTLYILSGVYEENVLI
YRSHLRIIGLGCVEITGKRYAQELDERGKRIETFGTPTLFLGGSDLVVENIVVSNTAGQG
PEIGQAIAVYAHCDLAVFRNCSFRGHQDTLFTGPLPPAPRERAEFGGIPLKEHHANYRQL
YQNCYIEGTVDFIFGGATAYFESCELRSLRHYDDQPGYITAASTPQGQKHGYVFHRCFLT
AAQGVTDVYLGRPWREYARTAFLNCQLGEHIHPLGWDNWNDPANEATVCYEEYSSAGAAV
LRRQRAAWAGCYEAGAETLGKEQVFADTDFWKREEG

Enzyme Prediction     

No EC number prediction in MGYG000001514_04793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	16	310	1.8e-79	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.90e-61	15	311	1	277	Pectinesterase.
COG4677	PemB	1.16e-55	26	298	94	377	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	2.07e-48	25	310	16	280	pectinesterase
PLN02708	PLN02708	7.26e-47	2	309	229	526	Probable pectinesterase/pectinesterase inhibitor
PLN02713	PLN02713	7.02e-46	10	310	246	529	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK49167.1	7.00e-200	17	336	2	321
AIQ34935.1	4.82e-167	16	333	2	319
AET61714.1	7.68e-167	17	333	2	318
ASR46794.1	2.55e-165	17	335	2	320
AIQ73518.1	2.90e-165	16	332	2	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	8.44e-32	12	310	5	283	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.57e-31	17	310	6	279	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.53e-26	47	298	38	264	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.93e-26	47	298	38	264	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	4.66e-19	40	305	30	318	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RXK7	3.65e-41	7	310	250	536	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
O49298	7.71e-41	16	331	251	542	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9STY3	1.92e-37	4	310	269	558	Probable pectinesterase/pectinesterase inhibitor 33 OS=Arabidopsis thaliana OX=3702 GN=PME33 PE=2 SV=1
Q9FHN5	5.37e-37	12	321	218	517	Probable pectinesterase/pectinesterase inhibitor 59 OS=Arabidopsis thaliana OX=3702 GN=PME59 PE=2 SV=1
O22149	5.52e-37	14	310	205	476	Probable pectinesterase/pectinesterase inhibitor 17 OS=Arabidopsis thaliana OX=3702 GN=PME17 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_04793.