CAZyme Information: MGYG000001514_04873

Basic Information

• Species: Paenibacillus_A ihumii
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A ihumii
• CAZyme ID: MGYG000001514_04873
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000001514_12|CGC63	84186.63	9.0592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001514	5923787	Isolate	not provided	not provided

• Gene Location: Start: 3679418; End: 3681676 Strand: -

Full Sequence      

MSIKVDPQKVDELSAQTKKFGAFIENVEWNVNESISQLVRDTQNQYPELYGRSELNEVER
LLNEIRKQAEGITGDLRDKAKVLTDAAARYRKDEEAVKTSTKKKYEPVPPSAYYSANGGL
SGKDLTSYLQDALFQDPVVQKLHQLALHGTEAEKKEAKEKLDAIFKARNTIARAQVAYTV
YKTFGNTYLMEQAHKEAMKQRGILKGYGINEELYGEKVNISEYYKGSPLEACSYDPSMQI
VKDGKFVQVLMPQDNQYQYLLGLVMKGGAQGAWAQKQLDEIHKQLGEIGRAQVAWHEYKA
KGMTKEMDGAHTYAEKVRGILKDKYGLSSAMVDGVIYKHLWTGAGPAGNYLRVQETVVFE
PKETPYESTVLDILLNPAYFSQVDSRWANKMYSKKNDKSQTIGTSGCGPTSMAMILSTLL
GREITPVELCDFALKHGYRTLDSGTSWGFYKAVAKEYGLECIQTSSISEVKKALGTGDSM
VVSSMGKGHFTKGGHFIVINGMESKGDDIWFSILDPNSKNTSYGKDGKIIVGTKDDGKVK
AIESVIKSEAKQYWIFTNPNPIKVKDGSSPISAIPETNVKKSGTPIKELSNNAVKFLHGS
EGFSAYVYKDQAGKDTIGYGHLIKPGEKFKEPMSEEEARALYNKDIKKFIDAVNEFDTKY
SLNLTQNQFDALVSFTYNLGENFWKGDSTLKKLLISGKYSNEELKKAFGMYHKVTENGVK
KASRGLYNRRIDEAEVFLYAEYKRDTARPLPK

Enzyme Prediction     

No EC number prediction in MGYG000001514_04873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	590	733	7e-31	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	9.40e-39	593	738	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	4.36e-21	585	739	3	149	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	1.17e-17	589	733	2	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16900	endolysin_R21-like	1.42e-15	593	738	8	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam13529	Peptidase_C39_2	5.02e-15	403	516	11	139	Peptidase_C39 like family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB43148.1	1.46e-154	4	751	10	653
AMC12668.1	3.01e-22	590	738	12	153
AGA64513.1	3.01e-22	590	738	12	153
QUN37948.1	7.40e-21	588	744	131	279
ACP20889.1	2.15e-20	576	744	421	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7M5I_A	7.70e-17	592	742	15	158	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6ET6_A	7.87e-12	579	738	42	194	ChainA, Lysozyme [Acinetobacter baumannii]
6H9D_A	1.62e-08	588	738	5	147	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	8.25e-07	588	693	3	108	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37896	2.83e-11	589	749	3	157	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
Q9T1T5	4.41e-10	589	737	3	143	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
P11187	5.53e-09	588	737	2	142	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P07540	1.34e-08	588	737	2	142	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
P09963	2.45e-06	588	693	3	108	Endolysin OS=Salmonella phage P22 OX=10754 GN=19 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001514_04873.